Diaphorina citri psyllid: psy5674


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MSSKAEKERQKQIQDKCQNLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARAVYEANIPDNFRRPQTDSTLEAFIRAKYEQKKYIASEWVPPVLPKNSFVG
cccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEccccEEEEccccccccccccccccEEECccccccHHHHHHHHHHcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccccccccccccc
*****************QNLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARAVYEANIPDNFRRPQTDSTLEAFIRAKYEQKK******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSKAEKERQKQIQDKCQNLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARAVYEANIPDNFRRPQTDSTLEAFIRAKYEQKKYIASEWVPPVLPKNSFVG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Stromal membrane-associated protein 1 GTPase activating protein that acts on ARF6. Plays a role in clathrin-dependent endocytosis. May play a role in erythropoiesis.confidentQ91VZ6
ADP-ribosylation factor GTPase-activating protein effector protein 2 GTPase-activating protein for the ADP ribosylation factor family.confidentP40529

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008060 [MF]ARF GTPase activator activityprobableGO:0030234, GO:0005096, GO:0030695, GO:0003674, GO:0008047, GO:0060589, GO:0005083
GO:0032850 [BP]positive regulation of ARF GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0046578, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0043085, GO:0032318, GO:0043547, GO:0051345, GO:0009966, GO:0032312, GO:0031323, GO:0030811, GO:0065007, GO:0044093, GO:0032012, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0065009, GO:0051336, GO:1900542, GO:0032320, GO:0031329, GO:0006140
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:2000369 [BP]regulation of clathrin-mediated endocytosisprobableGO:0032879, GO:0051049, GO:0051128, GO:0060627, GO:0065007, GO:0008150, GO:0048259, GO:0050794, GO:0030100, GO:0050789
GO:0005547 [MF]phosphatidylinositol-3,4,5-trisphosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044431 [CC]Golgi apparatus partprobableGO:0005737, GO:0005794, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0031532 [BP]actin cytoskeleton reorganizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0030276 [MF]clathrin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045648 [BP]positive regulation of erythrocyte differentiationprobableGO:0051094, GO:0050793, GO:0045646, GO:0065007, GO:0032844, GO:0045597, GO:0050789, GO:0045595, GO:0045639, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0050794, GO:0045637, GO:0048522
GO:0030136 [CC]clathrin-coated vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0031982
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CRR, chain A
Confidence level:very confident
Coverage over the Query: 8-136
View the alignment between query and template
View the model in PyMOL