Diaphorina citri psyllid: psy5714

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MSSSSQYQKWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALRRWGKTPLDEAKTFKRDRIIQILEGSLSSTSSAEDSEDESLQLPQITSKKT
cccccccccccccccEEEEcccccccccccEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEHHHHHHcccHHHHHHcccccHHHHHHcccHHHHHHHHHHccccccccccccccccccccccccc
**SSSQYQKWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALRRWGKTPLDEAKTFKRDRIIQILEGS*************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSSQYQKWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALRRWGKTPLDEAKTFKRDRIIQILEGSLSSTSSAEDSEDESLQLPQITSKKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutaminase liver isoform, mitochondrial Plays an important role in the regulation of glutamine catabolism. Promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. Increases cellular anti-oxidant function via NADH and glutathione production.confidentQ571F8
Glutaminase confidentQ3MEJ6
Glutaminase liver isoform, mitochondrial Plays an important role in the regulation of glutamine catabolism. Promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. Increases cellular anti-oxidant function via NADH and glutathione production. May play a role in preventing tumor proliferation.confidentQ9UI32

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051289 [BP]protein homotetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0008652 [BP]cellular amino acid biosynthetic processprobableGO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0044283, GO:1901576, GO:0044710, GO:0044711, GO:0006520, GO:0071704, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0044238, GO:1901564, GO:1901566, GO:0006082, GO:0046394, GO:0016053, GO:0044237
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UO9, chain A
Confidence level:very confident
Coverage over the Query: 1-89
View the alignment between query and template
View the model in PyMOL
Template: 1IKN, chain D
Confidence level:confident
Coverage over the Query: 48-144
View the alignment between query and template
View the model in PyMOL