Psyllid ID: psy5714

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MSSSSQYQKWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALRRWGKTPLDEAKTFKRDRIIQILEGSLSSTSSAEDSEDESLQLPQITSKKT
cccccccccccccccEEEEcccccccccccEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEHHHHHHcccHHHHHHccccHHHHHHHcccHHHHHHHHHHHcccccccccccccccccccccccc
ccccccEEccccccEEEEEccccccccccEEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHHHccccccccHHHHccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHccHHHHHHHHHHHcccccccccccccccccccEEEccc
mssssqyqkwdiltpifqvglpaksgvsgsMLVVVPntmgialfsppldalgnscrgvQFCEELVKTfnfhkydnlryaankidprkhkyssiGLSIVTLLFNAAAGNISAlrrwgktpldeaktfkrDRIIQILEgslsstssaedsedeslqlpqitskkt
mssssqyqkwdILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNIsalrrwgktpldeaktfkrdrIIQILEgslsstssaedsedeslqlpqitskkt
MSSSSQYQKWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALRRWGKTPLDEAKTFKRDRIIQIlegslsstssaedsedeslqlPQITSKKT
*******QKWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALRRWGKTPLDEAKTFKRDRIIQIL****************************
*SSSSQYQKWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYA***********SSIGLSIVTLLFNAAAGNISALRRWGKTPLDEAKTFKRDRIIQILEGS*************************
********KWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALRRWGKTPLDEAKTFKRDRIIQILEGSL************************
**SSSQYQKWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALRRWGKTPLDEAKTFKRDRIIQILEGSLSSTSS*****DESLQLPQIT****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSSQYQKWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALRRWGKTPLDEAKTFKRDRIIQILEGSLSSTSSAEDSEDESLQLPQITSKKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query163 2.2.26 [Sep-21-2011]
Q571F8602 Glutaminase liver isoform yes N/A 0.644 0.174 0.561 1e-30
P28492602 Glutaminase liver isoform no N/A 0.644 0.174 0.561 2e-30
Q9UI32602 Glutaminase liver isoform yes N/A 0.644 0.174 0.561 2e-30
Q19013605 Putative glutaminase DH11 yes N/A 0.754 0.203 0.4 2e-29
O94925669 Glutaminase kidney isofor no N/A 0.644 0.156 0.533 5e-29
D3Z7P3674 Glutaminase kidney isofor no N/A 0.644 0.155 0.533 5e-29
P13264674 Glutaminase kidney isofor no N/A 0.644 0.155 0.533 5e-29
Q93650583 Putative glutaminase F30F no N/A 0.760 0.212 0.380 4e-25
Q8YSZ5334 Glutaminase OS=Nostoc sp. yes N/A 0.374 0.182 0.557 2e-15
Q3MEJ6334 Glutaminase OS=Anabaena v yes N/A 0.404 0.197 0.530 2e-15
>sp|Q571F8|GLSL_MOUSE Glutaminase liver isoform, mitochondrial OS=Mus musculus GN=Gls2 PE=2 SV=2 Back     alignment and function desciption
 Score =  132 bits (332), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 77/105 (73%)

Query: 17  FQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNL 76
           F VGLPAKS VSG++L+VVPN MG+   SPPLD LGNS RG+ FC++LV  FNFH YDNL
Sbjct: 407 FHVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSQRGINFCQKLVSLFNFHNYDNL 466

Query: 77  RYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALRRWGKTPLD 121
           R+ A K+DPR+        ++V LLF A +G++SALRR+  + +D
Sbjct: 467 RHCARKLDPRREGGEVRNKTVVNLLFAAYSGDVSALRRFALSAMD 511
Plays an important role in the regulation of glutamine catabolism. Promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. Increases cellular anti-oxidant function via NADH and glutathione production.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: 2
>sp|P28492|GLSL_RAT Glutaminase liver isoform, mitochondrial OS=Rattus norvegicus GN=Gls2 PE=2 SV=3 Back     alignment and function description
>sp|Q9UI32|GLSL_HUMAN Glutaminase liver isoform, mitochondrial OS=Homo sapiens GN=GLS2 PE=1 SV=2 Back     alignment and function description
>sp|Q19013|GLSA_CAEEL Putative glutaminase DH11.1 OS=Caenorhabditis elegans GN=DH11.1 PE=3 SV=2 Back     alignment and function description
>sp|O94925|GLSK_HUMAN Glutaminase kidney isoform, mitochondrial OS=Homo sapiens GN=GLS PE=1 SV=1 Back     alignment and function description
>sp|D3Z7P3|GLSK_MOUSE Glutaminase kidney isoform, mitochondrial OS=Mus musculus GN=Gls PE=1 SV=1 Back     alignment and function description
>sp|P13264|GLSK_RAT Glutaminase kidney isoform, mitochondrial OS=Rattus norvegicus GN=Gls PE=1 SV=2 Back     alignment and function description
>sp|Q93650|GLSB_CAEEL Putative glutaminase F30F8.2 OS=Caenorhabditis elegans GN=F30F8.2 PE=3 SV=2 Back     alignment and function description
>sp|Q8YSZ5|GLSA_NOSS1 Glutaminase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=glsA PE=3 SV=1 Back     alignment and function description
>sp|Q3MEJ6|GLSA_ANAVT Glutaminase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=glsA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query163
332016590 731 Glutaminase kidney isoform, mitochondria 0.840 0.187 0.459 4e-41
307192336 627 Glutaminase kidney isoform, mitochondria 0.840 0.218 0.448 9e-41
307191532 616 Glutaminase kidney isoform, mitochondria 0.840 0.222 0.454 2e-40
357618015 627 putative glutaminase [Danaus plexippus] 0.736 0.191 0.497 8e-40
328787998 638 PREDICTED: glutaminase kidney isoform, m 0.730 0.186 0.487 1e-39
380012339 637 PREDICTED: glutaminase kidney isoform, m 0.730 0.186 0.487 1e-39
345479103 660 PREDICTED: glutaminase kidney isoform, m 0.736 0.181 0.479 3e-39
383848767 636 PREDICTED: glutaminase kidney isoform, m 0.730 0.187 0.481 5e-39
350419763 636 PREDICTED: glutaminase kidney isoform, m 0.730 0.187 0.475 1e-38
340718862 636 PREDICTED: glutaminase kidney isoform, m 0.730 0.187 0.475 1e-38
>gi|332016590|gb|EGI57471.1| Glutaminase kidney isoform, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  172 bits (436), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 113/185 (61%), Gaps = 48/185 (25%)

Query: 17  FQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNL 76
           F+VG+PAKSGVSGS+LVV+PN MGI  +SPPLD LGNSCRGVQFCEELV+ FNFH+YDNL
Sbjct: 530 FKVGIPAKSGVSGSLLVVIPNVMGICTWSPPLDPLGNSCRGVQFCEELVQEFNFHRYDNL 589

Query: 77  RYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALR----------------------- 113
           ++A NK DPR+HKY + GLSIV LLF+AA+G+++A+R                       
Sbjct: 590 KHATNKKDPRRHKYETKGLSIVNLLFSAASGDVTAMRRHRLSGMDMTLSDYDGRTALHLA 649

Query: 114 ------------------------RWGKTPLDEAKTFKRDRIIQILEG-SLSSTSSAEDS 148
                                   RWGK P+DEA+TF   ++++ L   +L   +  E+ 
Sbjct: 650 ASEGHLDCVEFLIEHCGVPHDPKDRWGKRPVDEAETFGHMQVVEYLNNYALVRKTELENK 709

Query: 149 EDESL 153
           +DE +
Sbjct: 710 QDECI 714

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307192336|gb|EFN75602.1| Glutaminase kidney isoform, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307191532|gb|EFN75035.1| Glutaminase kidney isoform, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|357618015|gb|EHJ71111.1| putative glutaminase [Danaus plexippus] Back     alignment and taxonomy information
>gi|328787998|ref|XP_392523.4| PREDICTED: glutaminase kidney isoform, mitochondrial isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380012339|ref|XP_003690243.1| PREDICTED: glutaminase kidney isoform, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|345479103|ref|XP_001601673.2| PREDICTED: glutaminase kidney isoform, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383848767|ref|XP_003700019.1| PREDICTED: glutaminase kidney isoform, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350419763|ref|XP_003492293.1| PREDICTED: glutaminase kidney isoform, mitochondrial-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340718862|ref|XP_003397882.1| PREDICTED: glutaminase kidney isoform, mitochondrial-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query163
FB|FBgn0261625 775 CG42708 [Drosophila melanogast 0.644 0.135 0.647 2.9e-36
ZFIN|ZDB-GENE-050204-3591 glsa "glutaminase a" [Danio re 0.644 0.177 0.590 1.2e-28
WB|WBGene00007480 841 glna-1 [Caenorhabditis elegans 0.601 0.116 0.57 4.4e-28
UNIPROTKB|E1BHZ6574 GLS2 "Uncharacterized protein" 0.674 0.191 0.558 6.3e-28
UNIPROTKB|E2QV76602 GLS2 "Uncharacterized protein" 0.674 0.182 0.549 2.1e-27
MGI|MGI:2143539602 Gls2 "glutaminase 2 (liver, mi 0.674 0.182 0.549 2.1e-27
UNIPROTKB|F1SLB4560 LOC100738224 "Uncharacterized 0.674 0.196 0.549 2.6e-27
RGD|620359602 Gls2 "glutaminase 2 (liver, mi 0.674 0.182 0.549 2.7e-27
UNIPROTKB|Q9UI32602 GLS2 "Glutaminase liver isofor 0.674 0.182 0.549 3.4e-27
ZFIN|ZDB-GENE-050208-408627 si:dkey-102c8.6 "si:dkey-102c8 0.644 0.167 0.542 6.4e-27
FB|FBgn0261625 CG42708 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 370 (135.3 bits), Expect = 2.9e-36, Sum P(2) = 2.9e-36
 Identities = 68/105 (64%), Positives = 88/105 (83%)

Query:    17 FQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNL 76
             F+VGLPAKSGVSG M++V+PN MGI  +SPPLD LGN+ RG+QFCEELV  FNFH+YDNL
Sbjct:   457 FKVGLPAKSGVSGGMMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNL 516

Query:    77 RYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALRRWGKTPLD 121
             ++ +NK DPRKH+Y + GLSIV LLF+AA+G+++ALRR   + +D
Sbjct:   517 KHLSNKKDPRKHRYETKGLSIVNLLFSAASGDVTALRRHRLSGMD 561
GO:0005739 "mitochondrion" evidence=ISS
GO:0004359 "glutaminase activity" evidence=ISS
GO:0006541 "glutamine metabolic process" evidence=ISS
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
ZFIN|ZDB-GENE-050204-3 glsa "glutaminase a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00007480 glna-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E1BHZ6 GLS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QV76 GLS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2143539 Gls2 "glutaminase 2 (liver, mitochondrial)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SLB4 LOC100738224 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|620359 Gls2 "glutaminase 2 (liver, mitochondrial)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UI32 GLS2 "Glutaminase liver isoform, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-408 si:dkey-102c8.6 "si:dkey-102c8.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9UI32GLSL_HUMAN3, ., 5, ., 1, ., 20.56190.64410.1744yesN/A
Q571F8GLSL_MOUSE3, ., 5, ., 1, ., 20.56190.64410.1744yesN/A
Q3MEJ6GLSA_ANAVT3, ., 5, ., 1, ., 20.53030.40490.1976yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
pfam04960286 pfam04960, Glutaminase, Glutaminase 8e-26
TIGR03814300 TIGR03814, Gln_ase, glutaminase A 2e-17
PRK00971307 PRK00971, PRK00971, glutaminase; Provisional 3e-17
COG2066309 COG2066, GlsA, Glutaminase [Amino acid transport a 5e-17
PRK12356319 PRK12356, PRK12356, glutaminase; Reviewed 2e-15
PRK12357326 PRK12357, PRK12357, glutaminase; Reviewed 2e-08
>gnl|CDD|191140 pfam04960, Glutaminase, Glutaminase Back     alignment and domain information 
 Score = 98.9 bits (247), Expect = 8e-26
 Identities = 29/57 (50%), Positives = 37/57 (64%)

Query: 17  FQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKY 73
           ++VGLPAKSGV G +L VVP  MGIA++SP LD  GNS  GV   E+L +      +
Sbjct: 230 YRVGLPAKSGVGGGILAVVPGVMGIAVWSPALDEAGNSVAGVAALEKLSQRLGLSIF 286

This family of enzymes deaminates glutamine to glutamate EC:3.5.1.2. Length = 286
>gnl|CDD|234362 TIGR03814, Gln_ase, glutaminase A Back     alignment and domain information
>gnl|CDD|234880 PRK00971, PRK00971, glutaminase; Provisional Back     alignment and domain information
>gnl|CDD|224977 COG2066, GlsA, Glutaminase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237073 PRK12356, PRK12356, glutaminase; Reviewed Back     alignment and domain information
>gnl|CDD|237074 PRK12357, PRK12357, glutaminase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 163
KOG0506|consensus622 100.0
PRK12356319 glutaminase; Reviewed 99.97
PRK00971307 glutaminase; Provisional 99.97
TIGR03814300 Gln_ase glutaminase A. This family describes the e 99.97
PF04960286 Glutaminase: Glutaminase; InterPro: IPR015868 Glut 99.96
COG2066309 GlsA Glutaminase [Amino acid transport and metabol 99.96
PRK12357326 glutaminase; Reviewed 99.96
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.05
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.02
PF1360630 Ank_3: Ankyrin repeat 98.96
PHA02791284 ankyrin-like protein; Provisional 98.91
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.81
PHA02875 413 ankyrin repeat protein; Provisional 98.78
PHA02791 284 ankyrin-like protein; Provisional 98.77
KOG4412|consensus226 98.76
PHA02743166 Viral ankyrin protein; Provisional 98.74
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 98.68
KOG0510|consensus 929 98.68
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 98.65
KOG0509|consensus 600 98.6
PHA02736154 Viral ankyrin protein; Provisional 98.6
PLN03192 823 Voltage-dependent potassium channel; Provisional 98.58
PHA02875 413 ankyrin repeat protein; Provisional 98.58
PHA03100 480 ankyrin repeat protein; Provisional 98.57
KOG4214|consensus117 98.56
KOG0512|consensus228 98.56
PHA02874 434 ankyrin repeat protein; Provisional 98.55
PHA02874 434 ankyrin repeat protein; Provisional 98.52
PHA02741169 hypothetical protein; Provisional 98.49
KOG0195|consensus 448 98.46
KOG4177|consensus 1143 98.46
PHA02878 477 ankyrin repeat protein; Provisional 98.45
PHA02741169 hypothetical protein; Provisional 98.44
PHA03100 480 ankyrin repeat protein; Provisional 98.44
PHA02795 437 ankyrin-like protein; Provisional 98.43
PHA03095 471 ankyrin-like protein; Provisional 98.42
PHA02884 300 ankyrin repeat protein; Provisional 98.41
PHA02743166 Viral ankyrin protein; Provisional 98.4
PHA02876 682 ankyrin repeat protein; Provisional 98.38
PHA02878 477 ankyrin repeat protein; Provisional 98.37
PHA03095 471 ankyrin-like protein; Provisional 98.35
KOG4412|consensus226 98.34
KOG4214|consensus117 98.34
KOG0515|consensus752 98.33
KOG0502|consensus296 98.31
PHA02859209 ankyrin repeat protein; Provisional 98.28
KOG0514|consensus452 98.27
PHA02946446 ankyin-like protein; Provisional 98.25
PHA02798 489 ankyrin-like protein; Provisional 98.25
PHA02946 446 ankyin-like protein; Provisional 98.24
PHA02736154 Viral ankyrin protein; Provisional 98.23
KOG0510|consensus 929 98.22
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.19
PLN03192 823 Voltage-dependent potassium channel; Provisional 98.17
PHA02730 672 ankyrin-like protein; Provisional 98.16
PHA02859209 ankyrin repeat protein; Provisional 98.13
PHA02798 489 ankyrin-like protein; Provisional 98.12
KOG0508|consensus 615 98.11
PHA02884 300 ankyrin repeat protein; Provisional 98.1
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 98.09
KOG0195|consensus 448 98.09
KOG0502|consensus296 98.09
PHA02989 494 ankyrin repeat protein; Provisional 98.09
KOG0515|consensus 752 98.08
KOG0508|consensus 615 98.04
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 98.03
KOG0509|consensus 600 98.01
PHA02876 682 ankyrin repeat protein; Provisional 98.0
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.0
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 97.99
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 97.98
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 97.97
PHA02989 494 ankyrin repeat protein; Provisional 97.96
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 97.96
PHA02795 437 ankyrin-like protein; Provisional 97.94
KOG0512|consensus228 97.94
KOG1710|consensus 396 97.93
KOG0505|consensus 527 97.9
KOG0507|consensus 854 97.86
TIGR00870 743 trp transient-receptor-potential calcium channel p 97.83
KOG0511|consensus 516 97.75
KOG4177|consensus 1143 97.7
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.7
PHA02917 661 ankyrin-like protein; Provisional 97.69
KOG0514|consensus452 97.67
KOG0505|consensus 527 97.63
PHA02917 661 ankyrin-like protein; Provisional 97.51
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 97.51
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 97.48
PHA02792 631 ankyrin-like protein; Provisional 97.47
PHA02730 672 ankyrin-like protein; Provisional 97.33
KOG3676|consensus 782 97.29
TIGR00870 743 trp transient-receptor-potential calcium channel p 97.27
KOG0818|consensus 669 97.17
KOG0705|consensus749 96.98
KOG0520|consensus 975 96.97
KOG2384|consensus 223 96.73
KOG0522|consensus 560 96.63
PHA02792 631 ankyrin-like protein; Provisional 96.62
KOG0507|consensus 854 96.62
KOG0783|consensus 1267 96.61
KOG1710|consensus 396 96.31
KOG0782|consensus1004 95.45
KOG0818|consensus 669 95.31
KOG0522|consensus 560 95.23
KOG4369|consensus 2131 94.99
KOG3676|consensus 782 94.96
KOG3609|consensus 822 94.43
KOG2384|consensus 223 94.22
KOG4369|consensus 2131 93.87
PF1360630 Ank_3: Ankyrin repeat 93.3
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 93.11
KOG0506|consensus622 92.32
KOG0705|consensus749 92.21
KOG0521|consensus785 88.97
KOG0782|consensus1004 88.5
KOG2505|consensus 591 86.92
KOG0783|consensus 1267 80.43
>KOG0506|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.9e-45  Score=328.05  Aligned_cols=145  Identities=52%  Similarity=0.901  Sum_probs=134.7

Q ss_pred             CCcccccccCCCCCceeeecCccccCCCcceEEEecCceeEEeecCCCCCCCCcHHHHHHHHHHHHhcCCcchhhhHhh-
Q psy5714           1 MSSSSQYQKWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYA-   79 (163)
Q Consensus         1 ~~~~~~~~~~~~~~~a~~vG~PaKsgv~G~~~~vvp~~~gi~~~sP~LD~~GNSv~g~~~~~~ls~~l~l~ifd~L~~~-   79 (163)
                      |-|||||..+  |+|||.||+||||||||+|+.|||++|||++|||+||+-|||+||++||+.|+..||||+||.|+|. 
T Consensus       412 MySCGMYD~S--GqFaFhVGLPAKSgVsG~mivVvPNVMGi~l~SPpLDklGNs~rGv~Fc~~Lvs~fNFHNYD~L~h~~  489 (622)
T KOG0506|consen  412 MYSCGMYDFS--GQFAFHVGLPAKSGVSGAMIVVVPNVMGIALYSPPLDKLGNSCRGVAFCRQLVSKFNFHNYDSLRHPD  489 (622)
T ss_pred             HHhccccccc--cceEEEecCcccccccccEEEEeccceeeeeccCCchhhcCccccHHHHHHHHHHhcccCchhhcccc
Confidence            6799999986  9999999999999999999999999999999999999999999999999999999999999999998 


Q ss_pred             hccCCCCCCcccccchhHHHHHHHHHcCChhhhh----------------------------------------------
Q psy5714          80 ANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALR----------------------------------------------  113 (163)
Q Consensus        80 ~~kidpr~~~~e~~~~~~~~L~~AA~~Gdl~~vk----------------------------------------------  113 (163)
                      ..|+||||..+..+.+.++++++||+.||+.++|                                              
T Consensus       490 ~~K~DPRR~~~~~~~~~~i~~~~aa~~GD~~alrRf~l~g~D~~~~DyD~RTaLHvAAaEG~v~v~kfl~~~~kv~~~~k  569 (622)
T KOG0506|consen  490 NRKIDPRREGGPRENDTVINVMYAAKNGDLSALRRFALQGMDLETKDYDDRTALHVAAAEGHVEVVKFLLNACKVDPDPK  569 (622)
T ss_pred             cccCCcccccCcccccchhhhhhhhhcCCHHHHHHHHHhcccccccccccchhheeecccCceeHHHHHHHHHcCCCChh
Confidence            5699999999888888888999999999999988                                              


Q ss_pred             -ccCCcHHHHHHHcCCHHHHHHHHhCCCCCCCCCC
Q psy5714         114 -RWGKTPLDEAKTFKRDRIIQILEGSLSSTSSAED  147 (163)
Q Consensus       114 -r~G~TPLh~Aa~~Gh~~vV~lLl~~GA~~~~~~~  147 (163)
                       |||||||++|.+++|.+|+++|.++-..++..|.
T Consensus       570 DRw~rtPlDdA~~F~h~~v~k~L~~~~~~y~~~~~  604 (622)
T KOG0506|consen  570 DRWGRTPLDDAKHFKHKEVVKLLEEAQYPYTLMPE  604 (622)
T ss_pred             hccCCCcchHhHhcCcHHHHHHHHHHhcccccCch
Confidence             8999999999999999999999987776655444

>PRK12356 glutaminase; Reviewed Back     alignment and domain information
>PRK00971 glutaminase; Provisional Back     alignment and domain information
>TIGR03814 Gln_ase glutaminase A Back     alignment and domain information
>PF04960 Glutaminase: Glutaminase; InterPro: IPR015868 Glutaminases (3 Back     alignment and domain information
>COG2066 GlsA Glutaminase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12357 glutaminase; Reviewed Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
3ss3_A479 Crystal Structure Of Mouse Glutaminase C, Ligand-Fr 1e-23
3unw_A534 Crystal Structure Of Human Gac In Complex With Glut 2e-23
3czd_A315 Crystal Structure Of Human Glutaminase In Complex W 6e-19
3vp4_A316 Crystal Structure Of Human Glutaminase In Complex W 6e-19
3if5_A456 Crystal Structure Analysis Of Mglu Length = 456 3e-12
1u60_A310 Mcsg Apc5046 Probable Glutaminase Ybas Length = 310 2e-11
2pby_A308 Probable Glutaminase From Geobacillus Kaustophilus 7e-10
3agf_A327 Crystal Structure Of Bacillus Glutaminase In The Pr 3e-04
>pdb|3SS3|A Chain A, Crystal Structure Of Mouse Glutaminase C, Ligand-Free Form Length = 479 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (261), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (77%)
Query: 17  FQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNL 76
           F VGLPAKSGV+G +L+VVPN MG+  +SPPLD +GNS +G+ FC +LV   NFH YDNL
Sbjct: 355 FHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNL 414
Query: 77  RYAANKIDPRKH 88
           R+ A K+DPR+ 
Sbjct: 415 RHFAKKLDPRRE 426
>pdb|3UNW|A Chain A, Crystal Structure Of Human Gac In Complex With Glutamate Length = 534 Back     alignment and structure
>pdb|3CZD|A Chain A, Crystal Structure Of Human Glutaminase In Complex With L-Glutamate Length = 315 Back     alignment and structure
>pdb|3VP4|A Chain A, Crystal Structure Of Human Glutaminase In Complex With Inhibitor 4 Length = 316 Back     alignment and structure
>pdb|3IF5|A Chain A, Crystal Structure Analysis Of Mglu Length = 456 Back     alignment and structure
>pdb|1U60|A Chain A, Mcsg Apc5046 Probable Glutaminase Ybas Length = 310 Back     alignment and structure
>pdb|2PBY|A Chain A, Probable Glutaminase From Geobacillus Kaustophilus Hta426 Length = 308 Back     alignment and structure
>pdb|3AGF|A Chain A, Crystal Structure Of Bacillus Glutaminase In The Presence Of 4.3m Nacl Length = 327 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
3uo9_A534 Glutaminase kidney isoform, mitochondrial; hydrola 2e-30
3agd_A456 Salt-tolerant glutaminase; glutaminase super famil 7e-29
3voy_A315 Glutaminase kidney isoform, mitochondrial; hydrola 4e-23
1u60_A310 Probable glutaminase YBAS; structural genomics, AP 3e-21
2pby_A308 Glutaminase; secsg, riken, structural genomics, PS 3e-20
1mki_A330 Probable glutaminase YBGJ; structural genomics, PS 4e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* Length = 534 Back     alignment and structure
 Score =  114 bits (286), Expect = 2e-30
 Identities = 48/111 (43%), Positives = 64/111 (57%), Gaps = 2/111 (1%)

Query: 16  IFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDN 75
            F VGLPAKSGV+G +L+VVPN MG+  +SPPLD +GNS +G+ FC +LV   NFH YDN
Sbjct: 403 AFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDN 462

Query: 76  LRYAANKIDPRKHKYSSIGLSIVTLLFNAAAGNISALRRWGKTPLDEAKTF 126
           LR+ A K+DPR+        S   L +  +     AL+      +      
Sbjct: 463 LRHFAKKLDPRREGGDQ-RHSFGPLDY-ESLQQELALKETVWKKVSPESNE 511
>3agd_A Salt-tolerant glutaminase; glutaminase super family, hydrolase; 2.20A {Micrococcus luteus} PDB: 3age_A* 3if5_A 3ih8_A 3ih9_A 3iha_A* 3ihb_A 2dfw_A Length = 456 Back     alignment and structure
>3voy_A Glutaminase kidney isoform, mitochondrial; hydrolase; 2.20A {Homo sapiens} PDB: 3czd_A 3voz_A* 3vp0_A* 3vp1_A* 3vp2_A 3vp3_A 3vp4_A Length = 315 Back     alignment and structure
>1u60_A Probable glutaminase YBAS; structural genomics, APC5046, PSI, protein structure initiat midwest center for structural genomics, MCSG; 1.61A {Escherichia coli} SCOP: e.3.1.2 Length = 310 Back     alignment and structure
>2pby_A Glutaminase; secsg, riken, structural genomics, PSI, protein structure initiative, riken structural genomics/proteomics initiative, RSGI; 2.07A {Geobacillus kaustophilus} Length = 308 Back     alignment and structure
>1mki_A Probable glutaminase YBGJ; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; HET: SEP; 2.00A {Bacillus subtilis} SCOP: e.3.1.2 PDB: 2osu_A* 3brm_A* 3agf_A Length = 330 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query163
3uo9_A534 Glutaminase kidney isoform, mitochondrial; hydrola 100.0
3voy_A315 Glutaminase kidney isoform, mitochondrial; hydrola 99.97
1u60_A310 Probable glutaminase YBAS; structural genomics, AP 99.97
2pby_A308 Glutaminase; secsg, riken, structural genomics, PS 99.97
3agd_A456 Salt-tolerant glutaminase; glutaminase super famil 99.96
1mki_A330 Probable glutaminase YBGJ; structural genomics, PS 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.34
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.31
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.29
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.28
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.19
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.13
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.1
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.1
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.03
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.02
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.01
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.01
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.01
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.01
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 98.99
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 98.99
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 98.98
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 98.97
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 98.97
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 98.97
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 98.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 98.97
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 98.97
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 98.97
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 98.96
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 98.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 98.96
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.96
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 98.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 98.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 98.95
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 98.94
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 98.94
2etb_A256 Transient receptor potential cation channel subfam 98.93
3hra_A201 Ankyrin repeat family protein; structural protein; 98.93
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 98.93
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 98.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 98.93
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 98.93
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 98.92
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 98.92
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 98.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 98.92
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 98.91
2rfa_A 232 Transient receptor potential cation channel subfa 98.9
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 98.9
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 98.89
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 98.89
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 98.89
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 98.88
3v31_A167 Ankyrin repeat family A protein 2; structural geno 98.88
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 98.88
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 98.87
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 98.87
2pnn_A273 Transient receptor potential cation channel subfa 98.87
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 98.87
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 98.86
3jxi_A260 Vanilloid receptor-related osmotically activated p 98.86
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 98.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 98.86
2rfa_A232 Transient receptor potential cation channel subfa 98.86
2pnn_A 273 Transient receptor potential cation channel subfa 98.86
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 98.85
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 98.85
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 98.85
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 98.85
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 98.84
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 98.84
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 98.83
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.82
3hra_A201 Ankyrin repeat family protein; structural protein; 98.81
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 98.8
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 98.8
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 98.8
3deo_A183 Signal recognition particle 43 kDa protein; chloro 98.78
1awc_B153 Protein (GA binding protein beta 1); complex (tran 98.77
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 98.77
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 98.75
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 98.74
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 98.74
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.74
1sw6_A327 Regulatory protein SWI6; transcription regulation, 98.73
2etb_A 256 Transient receptor potential cation channel subfam 98.73
3jxi_A 260 Vanilloid receptor-related osmotically activated p 98.72
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 98.7
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 98.7
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 98.67
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 98.67
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 98.63
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 98.57
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 98.57
1sw6_A327 Regulatory protein SWI6; transcription regulation, 98.52
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 98.4
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 98.39
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 98.33
>3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* Back     alignment and structure
Probab=100.00  E-value=5.6e-36  Score=268.82  Aligned_cols=92  Identities=51%  Similarity=0.863  Sum_probs=86.1

Q ss_pred             CCcccccccCCCCCceeeecCccccCCCcceEEEecCceeEEeecCCCCCCCCcHHHHHHHHHHHHhcCCcchhhhHhhh
Q psy5714           1 MSSSSQYQKWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYDNLRYAA   80 (163)
Q Consensus         1 ~~~~~~~~~~~~~~~a~~vG~PaKsgv~G~~~~vvp~~~gi~~~sP~LD~~GNSv~g~~~~~~ls~~l~l~ifd~L~~~~   80 (163)
                      |.|||||..  .|+|||+||+|||||||||||+||||++|||||||+||++|||++|+++||.|+++++||+||+++|+.
T Consensus       390 M~TCGmYD~--SGefA~rVGLPaKSGVgGGIlaVVPg~~GIav~SP~LD~~GNSvrG~~~le~Ls~~l~LhiFd~l~h~~  467 (534)
T 3uo9_A          390 MHSCGMYDF--SGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFA  467 (534)
T ss_dssp             HHHHSSGGG--HHHHHHHTCSCEEECTTSEEEEEETTTEEEEEECSCBCTTSCBHHHHHHHHHHHHHBSCSTTCCSSCCS
T ss_pred             HhHcCCcch--HHHHHHHcCCcccccccceEEEEeCCCcEEEEECCCCCCCCCcHHHHHHHHHHHHHhCccccccccccc
Confidence            889999997  599999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             ccCCCCCCcccccc
Q psy5714          81 NKIDPRKHKYSSIG   94 (163)
Q Consensus        81 ~kidpr~~~~e~~~   94 (163)
                      +|+|||++..+.+.
T Consensus       468 ~k~dpr~~~~~~~~  481 (534)
T 3uo9_A          468 KKLDPRREGGDQRH  481 (534)
T ss_dssp             SCBCTTSCCC----
T ss_pred             cccCcccccccccc
Confidence            99999999988653
>3voy_A Glutaminase kidney isoform, mitochondrial; hydrolase; 2.20A {Homo sapiens} PDB: 3czd_A 3voz_A* 3vp0_A* 3vp1_A* 3vp2_A 3vp3_A 3vp4_A Back     alignment and structure
>1u60_A Probable glutaminase YBAS; structural genomics, APC5046, PSI, protein structure initiat midwest center for structural genomics, MCSG; 1.61A {Escherichia coli} SCOP: e.3.1.2 Back     alignment and structure
>2pby_A Glutaminase; secsg, riken, structural genomics, PSI, protein structure initiative, riken structural genomics/proteomics initiative, RSGI; 2.07A {Geobacillus kaustophilus} Back     alignment and structure
>3agd_A Salt-tolerant glutaminase; glutaminase super family, hydrolase; 2.20A {Micrococcus luteus} PDB: 3age_A* 3if5_A 3ih8_A 3ih9_A 3iha_A* 3ihb_A 2dfw_A Back     alignment and structure
>1mki_A Probable glutaminase YBGJ; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; HET: SEP; 2.00A {Bacillus subtilis} SCOP: e.3.1.2 PDB: 2osu_A* 3brm_A* 3agf_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 163
d1u60a_309 e.3.1.2 (A:) Probable glutaminase YbaS {Escherichi 1e-25
d1mkia_328 e.3.1.2 (A:) Probable glutaminase YbgJ {Bacillus s 1e-21
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.003
>d1u60a_ e.3.1.2 (A:) Probable glutaminase YbaS {Escherichia coli [TaxId: 562]} Length = 309 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: beta-lactamase/transpeptidase-like
superfamily: beta-lactamase/transpeptidase-like
family: Glutaminase
domain: Probable glutaminase YbaS
species: Escherichia coli [TaxId: 562]

 Score = 97.2 bits (242), Expect = 1e-25
 Identities = 29/58 (50%), Positives = 37/58 (63%)

Query: 17  FQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYD 74
           ++VGLP KSGV G +L VVP  MGIA FSPPLD  GNS RG +    + K   ++ + 
Sbjct: 251 YRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYNVFK 308
>d1mkia_ e.3.1.2 (A:) Probable glutaminase YbgJ {Bacillus subtilis [TaxId: 1423]} Length = 328 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query163
d1u60a_309 Probable glutaminase YbaS {Escherichia coli [TaxId 99.97
d1mkia_328 Probable glutaminase YbgJ {Bacillus subtilis [TaxI 99.96
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.13
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.1
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.09
d1k1aa_ 228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.04
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.03
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.0
d1ixva_ 229 26S proteasome non-ATPase regulatory subunit 10, g 98.98
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 98.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 98.92
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 98.91
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 98.9
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 98.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 98.89
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 98.88
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 98.86
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 98.86
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 98.85
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 98.84
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 98.83
d1oy3d_ 255 Transcription factor inhibitor I-kappa-B-beta, IKB 98.81
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 98.8
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 98.78
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 98.77
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 98.75
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 98.72
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 98.72
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 98.69
d1iknd_ 221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 98.66
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 98.65
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 98.61
d1wdya_ 285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 98.54
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 98.46
d1sw6a_ 301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 97.88
>d1u60a_ e.3.1.2 (A:) Probable glutaminase YbaS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: beta-lactamase/transpeptidase-like
superfamily: beta-lactamase/transpeptidase-like
family: Glutaminase
domain: Probable glutaminase YbaS
species: Escherichia coli [TaxId: 562]

Probab=99.97  E-value=2.2e-32  Score=231.96  Aligned_cols=72  Identities=43%  Similarity=0.738  Sum_probs=70.2

Q ss_pred             CCcccccccCCCCCceeeecCccccCCCcceEEEecCceeEEeecCCCCCCCCcHHHHHHHHHHHHhcCCcchh
Q psy5714           1 MSSSSQYQKWDILTPIFQVGLPAKSGVSGSMLVVVPNTMGIALFSPPLDALGNSCRGVQFCEELVKTFNFHKYD   74 (163)
Q Consensus         1 ~~~~~~~~~~~~~~~a~~vG~PaKsgv~G~~~~vvp~~~gi~~~sP~LD~~GNSv~g~~~~~~ls~~l~l~ifd   74 (163)
                      |.|||||..  .|+|||+||+|||||||||||+||||++|||||||+||++|||++|+++||.|+++++||+|+
T Consensus       237 M~tcGmYd~--SG~fa~~VGlPaKSGVgGgIlavvPg~~gIav~SP~LD~~GNSv~G~~~le~ls~~~~l~iF~  308 (309)
T d1u60a_         237 MMMEGLYGR--SGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYNVFK  308 (309)
T ss_dssp             HHHHTTGGG--HHHHHHHTCSCEEECTTSEEEEEETTTEEEEEECSCBCTTSCBHHHHHHHHHHHHHHTCCTTC
T ss_pred             HHhcCCccc--ccchhheeCceeecCCCceEEEEeCCceEEEEECCCCCCCCCCHHHHHHHHHHHHHhCccccC
Confidence            789999997  599999999999999999999999999999999999999999999999999999999999994
>d1mkia_ e.3.1.2 (A:) Probable glutaminase YbgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure