Diaphorina citri psyllid: psy5718

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720

MSNNAPADREIAAEDSIRVVCRFRPLNHSEEKAGSKFIVKFPSGGEENGLSLGGKFYLFDKVFKPNATQEKVYDEAAKSIVSVQFVDADQYMVSVDRLRSDHQLKASTMCEHSLMHLIVFPGATERFVGKPEEVFEVIEEGKANRHIAVTNMNEHSSRSHSVFLINVKQENLENEKKLSGKLYLVDLAGSEKVSKTGAEGTVLDEAKNINKSLSADGAGKLEEEFTVARLYISKMKSEVKNLVARCTSMESSQAEEHKKAIEYEKELGETRLLLQTNERREQARKDLKGLEDTVTKELQTLHNLRKLFVQDLQARIKKSVTAEESEDDGGSLAQRQKISFLENNLDQLTKVHKQLVRDNADLRCELPKLEKRLRATMERVKLITTARRDYEQLQGEMTRLTQENESAKEEVKELITTARRDYEQLQGEMTRLTQENESAKEEVKEVLQALEELAVNYDQKSQEVETKNKEFETLTEELTLKQTTLNTTSTELQQIKDMSNHQKKRINEMLTNLLKDLCEIGLVIGSEGDMKVTSDGAGKLEEEFTVARLYISKMKWRNGETVKEDEQVNLADPVDMAASIAPTPESAPASILPAIPGSGLMLGSLSNEERQKLEEERERLYQQLDEKDEEINQQSQYAEKLKEQIMEQEEVSGLLVCGQTNERREQARKDLKGLEDTVTKELQTLHNLRKLFVQDQVTSSQRWPMATKPTSRTDCRHCIT

cccccccccccccccccEEEEEccccccHHHHccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHcccccEEEECcccHHHHHHHHcccccccccccccccccccEEcccccCEEcccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEccccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHcccccccccHHHHHEEcccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHcccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHccccc

****************IRVVCRFRPLNHSEEKAGSKFIVKFPSGGEENGLSLGGKFYLFDKVFKPNATQEKVYDEAAKSIVSVQFVDADQYMVSVDRLRSDHQLKASTMCEHSLMHLIVFPGATERFVGKPEEVFEVIEEGKANRHIAVTNMNEHSSRSHSVFLINVKQ********LSGKLYLVDLAGSEK***********DEAKNINKSLSADGAGKLEEEFTVARLYISKMKSEVKNLVARCTSMESSQAEEHKKAIEYEKELGETRLLLQTNERR*********LE****KELQTLHNLRKLFVQDLQA*************************FLENNLDQLTKVHKQLVRDNADLRCELPKLEKRLRATMERVKLITTA***********************************************************************************************************************INEMLTNLLKDLCEIGLVIGSEGDMKVTSDGAGKLEEEFTVARLYISKMKWRN************************************************************************************************LVC***********************ELQTLHNLRKLFVQ***********************C**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSNNAPADREIAAEDSIRVVCRFRPLNHSEEKAGSKFIVKFPSGGEENGLSLGGKFYLFDKVFKPNATQEKVYDEAAKSIVSVQFVDADQYMVSVDRLRSDHQLKASTMCEHSLMHLIVFPGATERFVGKPEEVFEVIEEGKANRHIAVTNMNEHSSRSHSVFLINVKQENLENEKKLSGKLYLVDLAGSEKVSKTGAEGTVLDEAKNINKSLSADGAGKLEEEFTVARLYISKMKSEVKNLVARCTSMESSQAEEHKKAIEYEKELGETRLxxxxxxxxxxxxxxxxxxxxxxxxxxxxLHNLRKLFVQDLQARIKKSVTAEESEDDGGSLAQRQKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVKLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTLKQTTLNTTSTELQQIKDMSNHQKKRINEMLTNLLKDLCEIGLVIGSEGDMKVTSDGAGKLEEEFTVARLYISKMKWRNGETVKEDEQVNLADPVDMAASIAPTPESAPASILPAIPGSGLMLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSGLLVxxxxxxxxxxxxxxxxxxxxxxxxxxxxLHNLRKLFVQDQVTSSQRWPMATKPTSRTDCRHCIT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003777 [MF]	microtubule motor activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0048518 [BP]	positive regulation of biological process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0035253 [CC]	ciliary rootlet	probable	GO:0005856, GO:0005575, GO:0043228, GO:0043231, GO:0043232, GO:0031514, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0044422, GO:0044441
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0016043 [BP]	cellular component organization	probable	GO:0008150, GO:0071840
GO:0008017 [MF]	microtubule binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0047496 [BP]	vesicle transport along microtubule	probable	GO:0051234, GO:0007017, GO:0046907, GO:0007018, GO:0006810, GO:0072384, GO:0030705, GO:0044765, GO:0010970, GO:0044763, GO:0044699, GO:0051648, GO:0051649, GO:0008150, GO:0009987, GO:0006928, GO:0051179, GO:0051640, GO:0051641

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BG2, chain A
Confidence level:very confident
Coverage over the Query: 11-270
View the alignment between query and template
View the model in PyMOL

Template: 3COB, chain A
Confidence level:very confident
Coverage over the Query: 14-301
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 542-553
View the alignment between query and template
View the model in PyMOL

Template: 2DFS, chain A
Confidence level:confident
Coverage over the Query: 432-478
View the alignment between query and template
View the model in PyMOL

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 381-485
View the alignment between query and template
View the model in PyMOL

Template: 4B6X, chain A
Confidence level:probable
Coverage over the Query: 626-679
View the alignment between query and template
View the model in PyMOL

Template: 3MQ7, chain A
Confidence level:probable
Coverage over the Query: 468-507
View the alignment between query and template
View the model in PyMOL

Template: 3HAJ, chain A
Confidence level:probable
Coverage over the Query: 250-457
View the alignment between query and template
View the model in PyMOL

Template: 3R2P, chain A
Confidence level:probable
Coverage over the Query: 540-703
View the alignment between query and template
View the model in PyMOL