Psyllid ID: psy5718
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 720 | ||||||
| 198456881 | 972 | GA20572 [Drosophila pseudoobscura pseudo | 0.740 | 0.548 | 0.462 | 1e-124 | |
| 242023696 | 952 | Kinesin heavy chain, putative [Pediculus | 0.75 | 0.567 | 0.464 | 1e-122 | |
| 328712810 | 979 | PREDICTED: kinesin heavy chain-like [Acy | 0.709 | 0.521 | 0.443 | 1e-122 | |
| 312383445 | 1139 | hypothetical protein AND_03432 [Anophele | 0.718 | 0.453 | 0.446 | 1e-121 | |
| 270014227 | 982 | kinesin heavy chain [Tribolium castaneum | 0.726 | 0.532 | 0.466 | 1e-121 | |
| 119113501 | 983 | AGAP000561-PA [Anopheles gambiae str. PE | 0.711 | 0.520 | 0.445 | 1e-120 | |
| 189241456 | 1101 | PREDICTED: similar to Kinesin heavy chai | 0.726 | 0.475 | 0.466 | 1e-120 | |
| 195150115 | 1211 | GL11356 [Drosophila persimilis] gi|19410 | 0.727 | 0.432 | 0.456 | 1e-120 | |
| 194757261 | 977 | GF11276 [Drosophila ananassae] gi|190622 | 0.731 | 0.539 | 0.454 | 1e-117 | |
| 332017463 | 969 | Kinesin heavy chain [Acromyrmex echinati | 0.718 | 0.533 | 0.440 | 1e-116 |
| >gi|198456881|ref|XP_001360474.2| GA20572 [Drosophila pseudoobscura pseudoobscura] gi|198135786|gb|EAL25049.2| GA20572 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
Score = 452 bits (1164), Expect = e-124, Method: Compositional matrix adjust.
Identities = 294/636 (46%), Positives = 370/636 (58%), Gaps = 103/636 (16%)
Query: 7 ADREIAAEDSIRVVCRFRPLNHSEEKAGSKFIVKFPSGGEENGLSLGGKFYLFDKVFKPN 66
A+REI AEDSI+VVCRFRPLN SEEKAGSKF+VKFP+ EEN +S+ GK YLFDKVFKPN
Sbjct: 3 AEREIPAEDSIKVVCRFRPLNDSEEKAGSKFVVKFPNNVEENCISIAGKVYLFDKVFKPN 62
Query: 67 ATQEKVY--------------------------------------DEAAKSI-------- 80
A+QEKVY D A + I
Sbjct: 63 ASQEKVYNEAAKSIVTDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDSAKQGIIPRIVNDI 122
Query: 81 --------VSVQF-VDADQYMVSVDRLRSDHQLKASTMCEHSLMHLIVF-PGATERFVGK 130
V+++F + Y + +D++R + + H + + + GATERFV
Sbjct: 123 FNHIYAMEVNLEFHIKVSYYEIYMDKIRDLLDVSKVNLSVHEDKNRVPYVKGATERFVSS 182
Query: 131 PEEVFEVIEEGKANRHIAVTNMNEHSSRSHSVFLINVKQENLENEKKLSGKLYLVDLAGS 190
PE+VFEVIEEGK+NRHIAVTNMNEHSSRSHSVFLINVKQENLEN+KKLSGKLYLVDLAGS
Sbjct: 183 PEDVFEVIEEGKSNRHIAVTNMNEHSSRSHSVFLINVKQENLENQKKLSGKLYLVDLAGS 242
Query: 191 EKVSKTGAEGTVLDEAKNINKSLSADG--------AGKLEEEF---TVARLYISKMKSEV 239
EKVSKTGAEGTVLDEAKNINKSLSA G K + + R+ +
Sbjct: 243 EKVSKTGAEGTVLDEAKNINKSLSALGNVISALADGNKTHIPYRDSKLTRILQESLGGNA 302
Query: 240 KNLVARCTSMESSQAEEHKKAIEYEKELGETRLLLQTNE--------RREQARKDLKGLE 291
+ + C S S E K +++ + + ++ NE RR + K+ G
Sbjct: 303 RTTIVICCSPASFNESETKSTLDFGRRAKTVKNVVCVNEELTAEEWKRRYEKEKEKNG-- 360
Query: 292 DTVTKELQTLHNLRKLFVQDLQARIKKSVTAEESEDDGGSLAQRQKISFLENNLDQLTKV 351
+ + KL ++ + R ++V AEE + + NL+
Sbjct: 361 -------RLKGKVEKLEIELARWRAGETVKAEE------QINMEDLMEASTPNLEVEAAQ 407
Query: 352 HKQLVRDNADLRCELPKLEKRLRATMERVKLITTARRDYEQLQG---EMTRLTQENESAK 408
K +A R L + + A ER +L T R Y+QL E+ + +Q E K
Sbjct: 408 QKAAEAASAAQRTALANMSASVAAD-ERARLATECERLYQQLDDKDEEINQQSQYAEQMK 466
Query: 409 EEV---KELITTARRDYEQLQGEMTRLTQENESAKEEVKEVLQALEELAVNYDQKSQEVE 465
E+V +ELI ARR+YE LQ EM R+ QENESAKEEVKEVLQALEELAVNYDQKSQE++
Sbjct: 467 EQVMEQEELIANARREYEALQSEMARIQQENESAKEEVKEVLQALEELAVNYDQKSQEID 526
Query: 466 TKNKEFETLTEELTLKQTTLNTTSTELQQIKDMSNHQKKRINEMLTNLLKDLCEIGLVIG 525
KNK+ + L EEL KQT N TSTELQQ+KDMS+HQKKRI EMLTNLL+DL E+G I
Sbjct: 527 NKNKDIDALNEELQQKQTVFNATSTELQQLKDMSSHQKKRITEMLTNLLRDLGEVGQAIA 586
Query: 526 ---SEGDMKVTS---DGAGKLEEEFTVARLYISKMK 555
S D+K+++ A K+EE+FT+ARLYISKMK
Sbjct: 587 PGDSAIDLKMSTLAGTDATKVEEDFTMARLYISKMK 622
|
Source: Drosophila pseudoobscura pseudoobscura Species: Drosophila pseudoobscura Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242023696|ref|XP_002432267.1| Kinesin heavy chain, putative [Pediculus humanus corporis] gi|212517676|gb|EEB19529.1| Kinesin heavy chain, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|328712810|ref|XP_001944740.2| PREDICTED: kinesin heavy chain-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|312383445|gb|EFR28533.1| hypothetical protein AND_03432 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|270014227|gb|EFA10675.1| kinesin heavy chain [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|119113501|ref|XP_310522.2| AGAP000561-PA [Anopheles gambiae str. PEST] gi|116130389|gb|EAA45075.2| AGAP000561-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|189241456|ref|XP_973415.2| PREDICTED: similar to Kinesin heavy chain CG7765-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195150115|ref|XP_002016000.1| GL11356 [Drosophila persimilis] gi|194109847|gb|EDW31890.1| GL11356 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|194757261|ref|XP_001960883.1| GF11276 [Drosophila ananassae] gi|190622181|gb|EDV37705.1| GF11276 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|332017463|gb|EGI58186.1| Kinesin heavy chain [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 720 | ||||||
| UNIPROTKB|O60282 | 957 | KIF5C "Kinesin heavy chain iso | 0.831 | 0.625 | 0.343 | 1.9e-108 | |
| UNIPROTKB|F1N945 | 995 | KIF5C "Uncharacterized protein | 0.827 | 0.598 | 0.346 | 3.9e-108 | |
| UNIPROTKB|E2RDZ9 | 957 | KIF5C "Uncharacterized protein | 0.831 | 0.625 | 0.347 | 2.7e-107 | |
| UNIPROTKB|F6RAG5 | 956 | KIF5C "Uncharacterized protein | 0.830 | 0.625 | 0.349 | 4.4e-107 | |
| ZFIN|ZDB-GENE-070629-4 | 962 | kif5bb "kinesin family member | 0.811 | 0.607 | 0.358 | 3.9e-106 | |
| UNIPROTKB|F1NE00 | 933 | KIF5C "Uncharacterized protein | 0.666 | 0.514 | 0.385 | 6.4e-106 | |
| UNIPROTKB|I3LUB8 | 946 | KIF5C "Uncharacterized protein | 0.831 | 0.633 | 0.347 | 2.7e-105 | |
| ZFIN|ZDB-GENE-070629-2 | 968 | kif5ba "kinesin family member | 0.816 | 0.607 | 0.353 | 4.4e-105 | |
| UNIPROTKB|E1C3A1 | 966 | KIF5B "Uncharacterized protein | 0.809 | 0.603 | 0.343 | 1.9e-104 | |
| UNIPROTKB|E2QTN0 | 963 | KIF5B "Uncharacterized protein | 0.809 | 0.605 | 0.338 | 1.3e-103 |
| UNIPROTKB|O60282 KIF5C "Kinesin heavy chain isoform 5C" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 782 (280.3 bits), Expect = 1.9e-108, Sum P(3) = 1.9e-108
Identities = 221/644 (34%), Positives = 325/644 (50%)
Query: 72 VYDEAAKSIVSVQF-VDADQYMVSVDRLRSDHQLKASTMCEHSLMHLIVF-PGATERFVG 129
++D +++F + + + +D++R + + + H + + + G TERFV
Sbjct: 116 IFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVS 175
Query: 130 KPEEVFEVIEEGKANRHIAVTNMNEHSSRSHSVFLINVKQENLENEKKLSGKLYLVDLAG 189
PEEV +VI+EGKANRH+AVTNMNEHSSRSHS+FLIN+KQEN+E EKKLSGKLYLVDLAG
Sbjct: 176 SPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAG 235
Query: 190 SEKVSKTGAEGTVLDEAKNINKSLSADG--AGKLEE---------EFTVARLYISKMKSE 238
SEKVSKTGAEG VLDEAKNINKSLSA G L E + + R+ +
Sbjct: 236 SEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGN 295
Query: 239 VKNLVARCTSMESSQAEEHKKAIEYEKELGETRLLLQTNERREQARKDLKGLEDTVTKEL 298
+ + C S E K + + + + + N E ++ K + ++
Sbjct: 296 CRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVN--LELTAEEWKKKYEKEKEKN 353
Query: 299 QTLHNLRKLFVQDLQARIKKSVTAEESEDDGGSLAQRQKISFLENNLDQLTKVHKQLVRD 358
+TL N+ +Q L+ + + E +D A+ QK NL+ ++ +
Sbjct: 354 KTLKNV----IQHLEMELNRWRNGEAVPEDEQISAKDQK------NLEPCDNT--PIIDN 401
Query: 359 NADLRCELPKLEKRLRATMERVKLITTARRDYEQLQGEMTRLTQENESAKEEV---KELI 415
A + + EK + E I++ R + E+ + +Q E K+++ EL+
Sbjct: 402 IAPVVAGISTEEKE-KYDEE----ISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELL 456
Query: 416 TTARRDYEQLQGEMTRLTQENESAKEEVKEVLQALEELAVNYDQKSQEVXXXXXXXXXXX 475
+ RRDYE++Q E+TRL ENE+AK+EVKEVLQALEELAVNYDQKSQEV
Sbjct: 457 ASTRRDYEKIQEELTRLQIENEAAKDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLT 516
Query: 476 XXXXXXXXXXXXXXXXXXXIKDMSNHQKKRINEMLTNLLKDLCEIGLVIGSEGDMKVTSD 535
++++SNHQKKR E+L LLKDL EIG +IG+ D+K +D
Sbjct: 517 DELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGEIGGIIGTN-DVKTLAD 575
Query: 536 GAGKLEEEFTVARLYISKMKWRNGETVKEDEQVNLADPVDMAASIAPTPESAPASILPA- 594
G +EEEFT+ARLYISKMK V +Q+ A A E A +L +
Sbjct: 576 VNGVIEEEFTMARLYISKMKSEVKSLVNRSKQLESAQMDSNRKMNASERELAACQLLISQ 635
Query: 595 ----IPGSGLMLGSLSNXXXXXXXXXXXXXXXXXXXKDEEINQQSQYAEKLKE---QIME 647
I + ++ + +E + + +K KE ++ +
Sbjct: 636 HEAKIKSLTDYMQNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQD 695
Query: 648 QEEVSGLLVCGQTNERREQARKDLKGLEDTVTKELQTLHNLRKL 691
EE+ L Q RE +K L L D + ++ + + +R L
Sbjct: 696 AEEMKKALE-QQMESHREAHQKQLSRLRDEIEEKQKIIDEIRDL 738
|
|
| UNIPROTKB|F1N945 KIF5C "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RDZ9 KIF5C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6RAG5 KIF5C "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070629-4 kif5bb "kinesin family member 5B, b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NE00 KIF5C "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LUB8 KIF5C "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070629-2 kif5ba "kinesin family member 5B, a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C3A1 KIF5B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QTN0 KIF5B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 720 | |||
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 4e-54 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 2e-36 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 3e-36 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 3e-36 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 2e-34 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 2e-29 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 7e-24 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 2e-22 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 2e-22 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 2e-21 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 3e-21 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 2e-20 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 2e-20 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 2e-19 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 5e-19 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 5e-19 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 7e-19 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 2e-18 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 5e-15 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-13 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 9e-12 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-10 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 5e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-09 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 1e-08 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-08 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 6e-08 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 6e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 8e-08 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 2e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-07 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 8e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-07 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 3e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-05 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 4e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-05 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 7e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 2e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-04 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 3e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 3e-04 | |
| PRK05771 | 646 | PRK05771, PRK05771, V-type ATP synthase subunit I; | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 7e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.001 | |
| PRK11448 | 1123 | PRK11448, hsdR, type I restriction enzyme EcoKI su | 0.001 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.001 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 0.002 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.002 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.004 |
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
Score = 189 bits (481), Expect = 4e-54
Identities = 71/96 (73%), Positives = 78/96 (81%)
Query: 122 GATERFVGKPEEVFEVIEEGKANRHIAVTNMNEHSSRSHSVFLINVKQENLENEKKLSGK 181
G TERFV PEEV EVI EGK+NR +A TNMNE SSRSHS+FLI +KQEN+E K GK
Sbjct: 166 GLTERFVSSPEEVLEVINEGKSNRAVASTNMNEESSRSHSIFLITLKQENVETGSKKRGK 225
Query: 182 LYLVDLAGSEKVSKTGAEGTVLDEAKNINKSLSADG 217
L+LVDLAGSEKVSKTGAEG L+EAK INKSLSA G
Sbjct: 226 LFLVDLAGSEKVSKTGAEGQTLEEAKKINKSLSALG 261
|
Members of this group have been associated with organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 325 |
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 720 | |||
| KOG0240|consensus | 607 | 100.0 | ||
| KOG0243|consensus | 1041 | 100.0 | ||
| KOG4280|consensus | 574 | 100.0 | ||
| KOG0245|consensus | 1221 | 100.0 | ||
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 100.0 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 100.0 | |
| KOG0242|consensus | 675 | 100.0 | ||
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 100.0 | |
| KOG0241|consensus | 1714 | 100.0 | ||
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 100.0 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 100.0 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 100.0 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 100.0 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 100.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 100.0 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 100.0 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 100.0 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 100.0 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 100.0 | |
| KOG0239|consensus | 670 | 100.0 | ||
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 100.0 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 100.0 | |
| KOG0247|consensus | 809 | 100.0 | ||
| KOG0244|consensus | 913 | 100.0 | ||
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 100.0 | |
| KOG0246|consensus | 676 | 100.0 | ||
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 100.0 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 100.0 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.55 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.52 | |
| KOG0161|consensus | 1930 | 97.47 | ||
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.46 | |
| KOG0161|consensus | 1930 | 97.34 | ||
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.23 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.2 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 97.19 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.14 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.14 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.07 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.07 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.06 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.06 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.05 | |
| KOG0977|consensus | 546 | 97.01 | ||
| KOG0996|consensus | 1293 | 96.95 | ||
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 96.77 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.58 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.55 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.54 | |
| KOG4674|consensus | 1822 | 96.53 | ||
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 96.52 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.49 | |
| KOG0250|consensus | 1074 | 96.44 | ||
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.3 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.17 | |
| KOG1029|consensus | 1118 | 96.14 | ||
| KOG0977|consensus | 546 | 96.13 | ||
| KOG0933|consensus | 1174 | 96.04 | ||
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 96.0 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 95.96 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.91 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 95.89 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.89 | |
| KOG0976|consensus | 1265 | 95.85 | ||
| KOG0996|consensus | 1293 | 95.84 | ||
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 95.83 | |
| KOG0971|consensus | 1243 | 95.8 | ||
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 95.75 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 95.74 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.65 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 95.52 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.45 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 95.42 | |
| KOG0612|consensus | 1317 | 95.38 | ||
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 95.35 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 95.29 | |
| KOG0250|consensus | 1074 | 95.11 | ||
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 95.01 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 95.0 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 94.93 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 94.88 | |
| KOG4643|consensus | 1195 | 94.79 | ||
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 94.52 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 94.43 | |
| KOG0933|consensus | 1174 | 94.34 | ||
| KOG0980|consensus | 980 | 94.29 | ||
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 94.27 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 94.15 | |
| KOG0976|consensus | 1265 | 94.02 | ||
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 93.88 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 93.86 | |
| KOG0994|consensus | 1758 | 93.82 | ||
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 93.77 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 93.71 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 93.65 | |
| KOG4674|consensus | 1822 | 93.62 | ||
| KOG0994|consensus | 1758 | 93.6 | ||
| KOG4302|consensus | 660 | 93.56 | ||
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 93.51 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 93.4 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 93.37 | |
| KOG0971|consensus | 1243 | 93.28 | ||
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 93.24 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 93.19 | |
| KOG4360|consensus | 596 | 92.99 | ||
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 92.94 | |
| KOG0018|consensus | 1141 | 92.94 | ||
| KOG0288|consensus | 459 | 92.9 | ||
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 92.9 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 92.85 | |
| KOG0964|consensus | 1200 | 92.53 | ||
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 92.31 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.08 | |
| KOG0995|consensus | 581 | 91.89 | ||
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 91.86 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 91.8 | |
| KOG4643|consensus | 1195 | 91.69 | ||
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 91.52 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 91.51 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 91.46 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 91.32 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 91.14 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 91.1 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 90.97 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 90.94 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 90.74 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 90.74 | |
| KOG0964|consensus | 1200 | 90.72 | ||
| KOG4593|consensus | 716 | 90.67 | ||
| KOG0980|consensus | 980 | 90.66 | ||
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 90.43 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 90.4 | |
| PRK09039 | 343 | hypothetical protein; Validated | 90.4 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 90.2 | |
| KOG0946|consensus | 970 | 90.08 | ||
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 90.01 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 89.88 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 89.7 | |
| KOG1853|consensus | 333 | 89.25 | ||
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 89.19 | |
| KOG0946|consensus | 970 | 88.82 | ||
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 88.74 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 88.66 | |
| KOG1937|consensus | 521 | 88.59 | ||
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 88.49 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 88.33 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 88.22 | |
| KOG0995|consensus | 581 | 88.15 | ||
| KOG2129|consensus | 552 | 88.1 | ||
| KOG0612|consensus | 1317 | 87.62 | ||
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 87.49 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 87.21 | |
| PF12072 | 201 | DUF3552: Domain of unknown function (DUF3552); Int | 87.12 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 86.38 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 86.29 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 86.2 | |
| KOG4438|consensus | 446 | 85.9 | ||
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 85.64 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 85.46 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 85.42 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 85.41 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 85.26 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 85.18 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 85.1 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 85.08 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 84.96 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 84.7 | |
| KOG0249|consensus | 916 | 84.7 | ||
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 84.69 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 84.49 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 84.47 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 84.35 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 84.14 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 83.67 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 83.46 | |
| KOG0804|consensus | 493 | 83.34 | ||
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 83.31 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 82.9 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 82.08 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 81.79 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 81.5 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 81.17 | |
| KOG0243|consensus | 1041 | 81.11 | ||
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 80.96 | |
| KOG0963|consensus | 629 | 80.93 | ||
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 80.92 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 80.7 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 80.59 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 80.54 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 80.35 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 80.25 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 80.21 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 80.16 | |
| KOG4302|consensus | 660 | 80.09 |
| >KOG0240|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-89 Score=748.28 Aligned_cols=461 Identities=46% Similarity=0.602 Sum_probs=406.7
Q ss_pred CCCCCCEEEEEeeCCCCchhhccCCceEEEecCCCccceeeeCC----eeeecceecCCCCChHHHHHHhhhhcceeeec
Q psy5718 11 IAAEDSIRVVCRFRPLNHSEEKAGSKFIVKFPSGGEENGLSLGG----KFYLFDKVFKPNATQEKVYDEAAKSIVSVQFV 86 (720)
Q Consensus 11 ~~~~~~IrV~vRVRPl~~~E~~~g~~~iv~~~~~~~~~~v~~~~----k~F~FD~VF~~~asQeeVY~~~~~plV~~vl~ 86 (720)
+.++|+|+|+||+||.+..|...++.+++.+.+.. .++.+.+ ++|.||+||+|+++|.+||..++.|+|++||.
T Consensus 3 d~~~~~IkV~cR~rP~n~~E~~~~~~~i~~~~~~~--~~v~~~~~~~~~~y~FDrVF~pnatQe~Vy~~~a~~Iv~dVL~ 80 (607)
T KOG0240|consen 3 DSAECSIKVVCRFRPLNGLENNLGSKFIDCFENGE--NTVVLETTKETKTYVFDRVFSPNATQEDVYEFAAKPIVDDVLL 80 (607)
T ss_pred CCCCCceEEEEEeecCCchhhhcCCcCccCCCCCc--ceEEEecccccccceeeeecCCCccHHHHHHHHHHHHHHHHhc
Confidence 45789999999999999999999999999888842 3777765 89999999999999999999999999999999
Q ss_pred C------------------------CCCceeehhhhhhhhhhhhhhcccccceeE-------------------------
Q psy5718 87 D------------------------ADQYMVSVDRLRSDHQLKASTMCEHSLMHL------------------------- 117 (720)
Q Consensus 87 G------------------------~~~~~GIIpRav~~LF~~i~~~~~~~~~~v------------------------- 117 (720)
| ++...|||||++++||++|+.+..+.+|+|
T Consensus 81 GYNGTvfaYGqT~sGKTytm~G~~~d~~~~GIipRi~~diF~~Iys~~~n~efhVkVsy~EIYmEKi~DLL~~~k~nlsv 160 (607)
T KOG0240|consen 81 GYNGTVFAYGQTGSGKTYTMEGIGHDPEEMGIIPRILNDIFDHIYSMEENLEFHVKVSYFEIYMEKIRDLLDPEKTNLSV 160 (607)
T ss_pred ccceeEEEecCCCCCcceeecccCCChhhcCcHHHHHHHHHHHHhcCcccceEEEEEEeehhhhhHHHHHhCcccCCcee
Confidence 8 445779999999999999999999989888
Q ss_pred -------EEecCcEEEEecChhhhHHHHHhhhccccceeccCCCCCCCceeEEEEEEEeeecCCcccccceeeeeeccCC
Q psy5718 118 -------IVFPGATERFVGKPEEVFEVIEEGKANRHIAVTNMNEHSSRSHSVFLINVKQENLENEKKLSGKLYLVDLAGS 190 (720)
Q Consensus 118 -------~~V~gltev~V~S~eev~~lL~~G~~~R~~~sT~~N~~SSRSH~IftI~v~q~~~~~~~~~~skL~lVDLAGS 190 (720)
+||+|+++++|.++++++++|+.|..+|++++|+||.+|||||+||+|+|.|.+..+.....|+|+|||||||
T Consensus 161 heDK~~v~~vkG~t~~~v~s~d~v~~~i~~g~~nr~va~t~mn~~sSRSHsIF~i~VkQ~n~e~~~~~~gkLyLVDLaGS 240 (607)
T KOG0240|consen 161 HEDKNRVPYVKGVTERFVSSPDEVLDVIDEGKSNRHVAVTNMNEHSSRSHSIFLIHVKQENVEDKRKLSGKLYLVDLAGS 240 (607)
T ss_pred ecccCCCceecCceeEEecCHHHHHHHHhcccccchhhhccccccccccceEEEEEEEeccccchhhccccEEEEEcccc
Confidence 8999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccccCCCcccchHHhhhhccCCccccCc--ccccCC-cccccccchhhhhhhh--------hhhccccCCcccHHHHHh
Q psy5718 191 EKVSKTGAEGTVLDEAKNINKSLSADGAG--KLEEEF-TVARLYISKMKSEVKN--------LVARCTSMESSQAEEHKK 259 (720)
Q Consensus 191 Er~~kt~~~g~rl~E~~~INkSL~aLg~V--aL~~~~-~hIPYRdSKLTrLLqd--------~mI~~iSPs~~~~~ETls 259 (720)
|+++++|+.|..+.|+++||+||+|||+| ||++|. +||||||||||||||| ++|+||||+..|..||.+
T Consensus 241 EkvsKtga~g~vleEaK~INkSLsaLgnvI~aLa~g~~shipYRDSKLTRILqdSLGGNsRTtlIi~csPss~n~~ET~S 320 (607)
T KOG0240|consen 241 EKVSKTGAEGAVLEEAKNINKSLSALGNVINALAEGPKSHIPYRDSKLTRILQDSLGGNSRTTLIICCSPSSLNEAETKS 320 (607)
T ss_pred cccCCCCccchhHHHHhhhhhhHHHHHHHHHHHhcCCCCCCcchhhHHHHHHHHHhCCCcceEEEEecCCcccccccccc
Confidence 99999999999999999999999999999 999995 9999999999999999 899999999999999999
Q ss_pred HHHHHHHhccccccchhhhHH---------HHHH---HHHHHHHHHHHHHHHHHHHhHHHHHHHHHHhhccccccccccC
Q psy5718 260 AIEYEKELGETRLLLQTNERR---------EQAR---KDLKGLEDTVTKELQTLHNLRKLFVQDLQARIKKSVTAEESED 327 (720)
Q Consensus 260 TL~fa~rak~Ikn~~~vN~~~---------~~~~---~~Lk~ei~~Lk~EL~~l~nlrk~~~qdl~~r~g~~~~~~e~~~ 327 (720)
||+||.||+.|+|.+.+|... +.+. ..+...++.+..+|.+| +.|..++.+++..
T Consensus 321 Tl~fg~rak~ikN~v~~n~e~~~e~~~r~~e~~kd~~~~~~~~~~~~~~sl~~~-------------~~~E~~~~de~~~ 387 (607)
T KOG0240|consen 321 TLRFGNRAKTIKNTVWVNLELTAEEWKRKLEKKKDKNVALKEELEKLRNSLKRW-------------RNGEEVKEDEDFS 387 (607)
T ss_pred chhhccccccccchhhhhhHhhHHHHHHHHHHHHhHHHHHHHHHHHHHHHHhhh-------------cccCcccchhhhh
Confidence 999999999999999999922 2222 34445555556666667 7788777666554
Q ss_pred CCCchHHHhHHHHHhhhhHHHHHHHHHHHhhhhcccccchhHHHhh--hhhHHHHHHHHHHHHHHHHHHH---HHHHHHH
Q psy5718 328 DGGSLAQRQKISFLENNLDQLTKVHKQLVRDNADLRCELPKLEKRL--RATMERVKLITTARRDYEQLQG---EMTRLTQ 402 (720)
Q Consensus 328 ~~~~~~~~qki~~le~~Le~L~~~~~qLv~dn~~l~~elp~~~~~~--~~~~Er~k~~ee~~~l~~ql~~---Ei~~~~q 402 (720)
.... .+... ..++.......+ ..+.+..++.+++..+|+|+|+ ++|+++|
T Consensus 388 ~~~~----~k~~~---------------------~~~~~~~~i~~~~~~~~~~~~~~~e~~~~L~qqlD~kd~~~n~~sq 442 (607)
T KOG0240|consen 388 LKEE----AKMSA---------------------ILSEEEMSITKLKGSLEEEEDILTERIESLYQQLDQKDDQINKQSQ 442 (607)
T ss_pred HHHH----HHhhh---------------------hhhhhhhhhhhcccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 2211 10000 000000000111 2567788899999999999888 9999999
Q ss_pred HHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHH
Q psy5718 403 ENESAKEEV---KELITTARRDYEQLQGEMTRLTQENESAKEEVKEVLQALEELAVNYDQKSQEVETKNKEFETLTEELT 479 (720)
Q Consensus 403 ~~ekLkeq~---eell~~~~~~~e~lq~el~~lq~e~~~~keevke~~qaleel~~n~d~~~~e~e~~~~e~~~l~~el~ 479 (720)
+.++|+.|+ +++++..+++|+..|.++.++|++++.++++++++++||++|++|||+++++.+.+...+
T Consensus 443 L~~~lk~q~~~qee~~s~~~~~~e~~q~e~~~~Q~~~e~~~~e~~e~~~al~el~~~~~~~~~~~~~~~~~n-------- 514 (607)
T KOG0240|consen 443 LMEKLKEQLLDQEELLSSTRRLYEDIQQELSEIQEENEAAKDEVKEVLTALEELAVNYDQKSEEKESKLSQN-------- 514 (607)
T ss_pred HHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHhhhhhhh--------
Confidence 999999999 899999999999999999999999999999999999999999999999999988877666
Q ss_pred HHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHhHHhhhhcCC
Q psy5718 480 LKQTTLNTTSTELQQIKDMSNHQKKRINEMLTNLLKDLCEIGLVIGSE 527 (720)
Q Consensus 480 ~~~~~~~~l~~el~~l~~~~~~~~kr~~e~~~~l~~dl~e~~~~~~~~ 527 (720)
+.+||+.+++.++||++||+++++.|++|+++||..+|++
T Consensus 515 --------~~sel~sl~~~~~~~~~r~~~~~~~l~~~~~~~~~~~~~~ 554 (607)
T KOG0240|consen 515 --------LKSELQSLQEPSEHQSKRITELLSELRKDLGEIGWKIGTS 554 (607)
T ss_pred --------hHHHHHhhhhcccchhHHHHHHHHHHHhhhccccccccCC
Confidence 8899999999999999999999999999999999999998
|
|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG4302|consensus | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >KOG0288|consensus | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >KOG4593|consensus | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG0946|consensus | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG1853|consensus | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG0946|consensus | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG1937|consensus | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >KOG2129|consensus | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF12072 DUF3552: Domain of unknown function (DUF3552); InterPro: IPR022711 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4438|consensus | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG0249|consensus | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG4302|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 720 | ||||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 7e-66 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 7e-48 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 8e-48 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 1e-47 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 2e-38 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 2e-25 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 1e-19 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 3e-17 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 2e-16 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 6e-16 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 1e-15 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 5e-15 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 1e-14 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 1e-13 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 1e-13 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 1e-13 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 1e-13 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 1e-13 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 1e-13 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-13 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 1e-13 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 1e-13 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 1e-13 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 1e-13 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 2e-13 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 2e-13 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 3e-13 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 1e-12 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 1e-12 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 2e-12 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 4e-12 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 4e-12 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 5e-12 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 8e-12 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 8e-12 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 9e-12 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-11 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 3e-11 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 6e-11 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 6e-11 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 8e-11 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 3e-10 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 7e-10 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 8e-10 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 3e-08 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 3e-07 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 5e-07 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 6e-07 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 6e-07 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 6e-07 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 3e-06 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 3e-06 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 4e-06 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 4e-06 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 5e-06 | ||
| 1ry6_A | 360 | Crystal Structure Of Internal Kinesin Motor Domain | 1e-04 |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
|
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 720 | |||
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 2e-61 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 9e-55 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 4e-49 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 4e-49 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 1e-48 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 3e-46 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 4e-18 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 2e-45 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 1e-44 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 4e-20 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 6e-43 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 5e-15 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 1e-42 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 2e-14 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 5e-42 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 2e-12 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 7e-42 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 5e-10 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 1e-41 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 1e-11 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 1e-40 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 6e-12 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 1e-39 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 2e-15 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 2e-39 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 1e-13 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 4e-39 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 8e-16 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 8e-39 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 2e-14 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 3e-37 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 5e-12 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 5e-37 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 4e-16 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 5e-37 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 1e-09 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 1e-35 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 5e-13 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 3e-34 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 9e-09 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 2e-32 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 9e-09 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 8e-30 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 5e-10 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 1e-29 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 5e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-15 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-14 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-10 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 6e-05 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 3e-04 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 4e-04 |
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
Score = 208 bits (531), Expect = 2e-61
Identities = 78/264 (29%), Positives = 116/264 (43%), Gaps = 61/264 (23%)
Query: 12 AAEDSIRVVCRFRPLNHSEEKAGS-KFIVKFPSGGEENGLSLGG---KFYLFDKVFKPNA 67
++ +IRV+ R RP+ + + V F + + L + DKVF P A
Sbjct: 1 GSKGNIRVIARVRPVTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQA 60
Query: 68 TQEKVYDEAAKSIVSV------------Q--------------------------FVDAD 89
+Q+ V+ E + S Q F +
Sbjct: 61 SQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENPGINQRALQLLFSEVQ 120
Query: 90 ------QYMVSV-----------DRLRSDHQLKAS-TMCEHSLMHLIVFPGATERFVGKP 131
+Y ++V D L + Q K +C L V PG TE V
Sbjct: 121 EKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYV-PGLTEFQVQSV 179
Query: 132 EEVFEVIEEGKANRHIAVTNMNEHSSRSHSVFLINVKQENLENEKKLSGKLYLVDLAGSE 191
+++ +V E G NR TN+NEHSSRSH++ ++ V+ + + +GKL LVDLAGSE
Sbjct: 180 DDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSE 239
Query: 192 KVSKTGAEGTVLDEAKNINKSLSA 215
+V K+GAEG+ L EA++INKSLSA
Sbjct: 240 RVGKSGAEGSRLREAQHINKSLSA 263
|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 720 | |||
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 100.0 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 100.0 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 100.0 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 100.0 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 100.0 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 100.0 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 100.0 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 100.0 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 100.0 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 100.0 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 100.0 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 100.0 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 100.0 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 100.0 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 100.0 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 100.0 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 100.0 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 100.0 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 100.0 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 100.0 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 100.0 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 100.0 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 100.0 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 100.0 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 100.0 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 100.0 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 99.87 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 99.86 | |
| 2o0a_A | 298 | S.cerevisiae chromosome XVI reading frame ORF YPL2 | 99.07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.2 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.99 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.32 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 96.28 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.95 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 94.74 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.29 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.27 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 93.9 | |
| 4b6x_A | 90 | AVRRPS4, avirulence protein; toxin, type 3 secrete | 93.31 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 93.01 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 92.92 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 92.74 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 91.6 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 91.41 | |
| 1deb_A | 54 | APC protein, adenomatous polyposis coli protein; c | 91.23 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 90.8 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 90.29 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 90.07 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 88.63 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 87.36 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 87.34 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 84.27 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 84.21 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 84.0 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 83.82 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 83.62 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 82.47 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 82.31 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 82.1 | |
| 3s84_A | 273 | Apolipoprotein A-IV; four helix bundle, transport | 81.75 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 81.2 | |
| 3r2p_A | 185 | Apolipoprotein A-I; amphipathic alpha-helix, major | 80.58 |
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-65 Score=558.44 Aligned_cols=272 Identities=60% Similarity=0.800 Sum_probs=234.7
Q ss_pred cCCCCCCCEEEEEeeCCCCchhhccCCceEEEecCCCccceeeeCCeeeecceecCCCCChHHHHHHhhhhcceeeecC-
Q psy5718 9 REIAAEDSIRVVCRFRPLNHSEEKAGSKFIVKFPSGGEENGLSLGGKFYLFDKVFKPNATQEKVYDEAAKSIVSVQFVD- 87 (720)
Q Consensus 9 ~~~~~~~~IrV~vRVRPl~~~E~~~g~~~iv~~~~~~~~~~v~~~~k~F~FD~VF~~~asQeeVY~~~~~plV~~vl~G- 87 (720)
|+.+.+++|+|+|||||+++.|...+...++.++++.....+.++++.|.||+||+++++|++||+.++.|+|+++|+|
T Consensus 5 ~~~~~~~~i~V~vRvRP~~~~E~~~~~~~~v~~~~~~~~~~i~~~~~~f~FD~Vf~~~~~Q~~Vy~~~~~plv~~~l~G~ 84 (365)
T 2y65_A 5 REIPAEDSIKVVCRFRPLNDSEEKAGSKFVVKFPNNVEENCISIAGKVYLFDKVFKPNASQEKVYNEAAKSIVTDVLAGY 84 (365)
T ss_dssp ---CCEEECEEEEEECCCCHHHHHTTCCBCEECCSSSTTCEEEETTEEEECSEEECTTCCHHHHHHHHTHHHHHHHHTTC
T ss_pred ccCCCCCCeEEEEEcCcCChhHhccCCceEEEeCCCCCCcEEEECCEEEeCceEecCCCCHHHHHHHhhhhHHHHHhCCC
Confidence 4566789999999999999999888888889888764445788899999999999999999999999999999999999
Q ss_pred -----------------------CCCceeehhhhhhhhhhhhhhcccccceeE---------------------------
Q psy5718 88 -----------------------ADQYMVSVDRLRSDHQLKASTMCEHSLMHL--------------------------- 117 (720)
Q Consensus 88 -----------------------~~~~~GIIpRav~~LF~~i~~~~~~~~~~v--------------------------- 117 (720)
++..+|||||++.+||..+........|.+
T Consensus 85 n~tifAYGqTGSGKTyTm~G~~~~~~~~Giipr~~~~lF~~i~~~~~~~~~~v~vS~~EIYnE~i~DLL~~~~~~l~i~e 164 (365)
T 2y65_A 85 NGTIFAYGQTSSGKTHTMEGVIGDSVKQGIIPRIVNDIFNHIYAMEVNLEFHIKVSYYEIYMDKIRDLLDVSKVNLSVHE 164 (365)
T ss_dssp CEEEEEECSTTSSHHHHHTBSTTCTTTBCHHHHHHHHHHHHHHHCCSCEEEEEEEEEEEEETTEEEETTCTTCCSBCEEE
T ss_pred ceEEEeecCCCCCCceEEecCCCCcccCChHHHHHHHHHHHHHhccCCceEEEEEEEEEEECCeeeecccCCcCCceEEE
Confidence 245689999999999999987655554444
Q ss_pred -----EEecCcEEEEecChhhhHHHHHhhhccccceeccCCCCCCCceeEEEEEEEeeecCCcccccceeeeeeccCCcc
Q psy5718 118 -----IVFPGATERFVGKPEEVFEVIEEGKANRHIAVTNMNEHSSRSHSVFLINVKQENLENEKKLSGKLYLVDLAGSEK 192 (720)
Q Consensus 118 -----~~V~gltev~V~S~eev~~lL~~G~~~R~~~sT~~N~~SSRSH~IftI~v~q~~~~~~~~~~skL~lVDLAGSEr 192 (720)
+||+|++++.|.|+++++.+|..|.++|++++|.||..|||||+||+|+|.+.+...+....|+|+|||||||||
T Consensus 165 ~~~~~~~v~gl~~~~V~s~~e~~~ll~~g~~~R~~~~T~~N~~SSRSH~if~i~v~~~~~~~~~~~~skL~lVDLAGSEr 244 (365)
T 2y65_A 165 DKNRVPYVKGATERFVSSPEDVFEVIEEGKSNRHIAVTNMNEHSSRSHSVFLINVKQENLENQKKLSGKLYLVDLAGSEK 244 (365)
T ss_dssp CSSSCEEETTCCCEEECSHHHHHHHHHHHHHHHTTTCSCHHHHHHTSEEEEEEEEEEEETTTCCEEEEEEEEEECCCCCC
T ss_pred CCCCCEEecCCEEEecCCHHHHHHHHHHHHhhcccccccCCCCCCCceEEEEEEEEEEecCCCCEeEEEEEEEECCCCCc
Confidence 799999999999999999999999999999999999999999999999999998888888899999999999999
Q ss_pred cccCCCcccchHHhhhhccCCccccCc--ccccCC-cccccccchhhhhhhh--------hhhccccCCcccHHHHHhHH
Q psy5718 193 VSKTGAEGTVLDEAKNINKSLSADGAG--KLEEEF-TVARLYISKMKSEVKN--------LVARCTSMESSQAEEHKKAI 261 (720)
Q Consensus 193 ~~kt~~~g~rl~E~~~INkSL~aLg~V--aL~~~~-~hIPYRdSKLTrLLqd--------~mI~~iSPs~~~~~ETlsTL 261 (720)
++++++.|.+++|+.+||+||++||+| +|+++. .||||||||||+|||| +||+||||+..+++||++||
T Consensus 245 ~~~t~~~g~rl~E~~~INkSL~aLg~vI~aL~~~~~~hvPyRdSkLT~lLqdsLgGnskt~mI~~isP~~~~~~ETl~TL 324 (365)
T 2y65_A 245 VSKTGAEGTVLDEAKNINKSLSALGNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIVICCSPASFNESETKSTL 324 (365)
T ss_dssp ----------------CCHHHHHHHHHHHHHHHCCCSCCCGGGCHHHHHTGGGTTSSSEEEEEEEECCBGGGHHHHHHHH
T ss_pred chhcCCcchhHHHHHHHHHHHHHHHHHHHHHhcCCCCCCccccCHHHHHHHhhcCCCccEEEEEEecCccCCHHHHHHHH
Confidence 999999999999999999999999999 999875 8999999999999999 89999999999999999999
Q ss_pred HHHHHhccccccchhhhHH
Q psy5718 262 EYEKELGETRLLLQTNERR 280 (720)
Q Consensus 262 ~fa~rak~Ikn~~~vN~~~ 280 (720)
+||.||+.|+|.|.+|...
T Consensus 325 ~fA~rak~I~n~~~~n~~~ 343 (365)
T 2y65_A 325 DFGRRAKTVKNVVCVNEEL 343 (365)
T ss_dssp HHHHHHTTCEEECCCEEEC
T ss_pred HHHHHHhcccCcceeCCCC
Confidence 9999999999999999854
|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4b6x_A AVRRPS4, avirulence protein; toxin, type 3 secreted effector; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3r2p_A Apolipoprotein A-I; amphipathic alpha-helix, major protein of high density lipop (HDL), lipid binding, plasma, lipid transport; 2.20A {Homo sapiens} PDB: 1gw3_A 1gw4_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 720 | ||||
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 1e-22 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 1e-15 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 9e-14 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 1e-13 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 9e-14 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 5e-11 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 9e-13 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 7e-09 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 1e-12 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 2e-12 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 7e-12 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 4e-09 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 2e-10 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 2e-09 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 7e-08 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 1e-07 |
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Human (Homo sapiens) [TaxId: 9606]
Score = 97.3 bits (241), Expect = 1e-22
Identities = 107/265 (40%), Positives = 136/265 (51%), Gaps = 67/265 (25%)
Query: 13 AEDSIRVVCRFRPLNHSEEKAGSKFIVKFPSGGEENGLSLGGKFY--------------L 58
AE +I+V+CRFRPLN SE G K+I KF E+ + + K Y +
Sbjct: 3 AECNIKVMCRFRPLNESEVNRGDKYIAKFQG---EDTVVIASKPYAFDRVFQSSTSQEQV 59
Query: 59 FDKVFKP----------------------------------------------NATQEKV 72
++ K
Sbjct: 60 YNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIYS 119
Query: 73 YDEAAKSIVSVQFVDADQYMVSVDRLRSDHQLKASTMCEHSLMHLIVFPGATERFVGKPE 132
DE + + V + + Y+ + L + S + + + + G TERFV P+
Sbjct: 120 MDENLEFHIKVSYFEI--YLDKIRDLLDVSKTNLSVHEDKNRVPYV--KGCTERFVCSPD 175
Query: 133 EVFEVIEEGKANRHIAVTNMNEHSSRSHSVFLINVKQENLENEKKLSGKLYLVDLAGSEK 192
EV + I+EGK+NRH+AVTNMNEHSSRSHS+FLINVKQEN + E+KLSGKLYLVDLAGSEK
Sbjct: 176 EVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEK 235
Query: 193 VSKTGAEGTVLDEAKNINKSLSADG 217
VSKTGAEG VLDEAKNINKSLSA G
Sbjct: 236 VSKTGAEGAVLDEAKNINKSLSALG 260
|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 720 | |||
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 100.0 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 100.0 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 100.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 100.0 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 100.0 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 100.0 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 100.0 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 81.36 |
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin heavy chain-like protein species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=100.00 E-value=2.4e-58 Score=500.50 Aligned_cols=280 Identities=29% Similarity=0.320 Sum_probs=239.9
Q ss_pred CEEEEEeeCCCCchhhccCCceEEEecCCCccceeee-----CCeeeecceecCCCCChHHHHHHhhhhcceeeecC---
Q psy5718 16 SIRVVCRFRPLNHSEEKAGSKFIVKFPSGGEENGLSL-----GGKFYLFDKVFKPNATQEKVYDEAAKSIVSVQFVD--- 87 (720)
Q Consensus 16 ~IrV~vRVRPl~~~E~~~g~~~iv~~~~~~~~~~v~~-----~~k~F~FD~VF~~~asQeeVY~~~~~plV~~vl~G--- 87 (720)
+|+|+|||||+++.|...+...++...++. ++.. .++.|.||+||+++++|++||+.+ .|+|+++|+|
T Consensus 1 rIkV~vRvRP~~~~E~~~~~~~~v~~~~~~---~~~~~~~~~~~~~f~FD~vf~~~~~q~~vy~~v-~~lv~~~l~G~n~ 76 (364)
T d1sdma_ 1 KIRVYCRLRPLCEKEIIAKERNAIRSVDEF---TVEHLWKDDKAKQHMYDRVFDGNATQDDVFEDT-KYLVQSAVDGYNV 76 (364)
T ss_dssp CCEEEEEECCCCHHHHHTTCCBCEEECSTT---EEEEECSSSSEEEEECSEEECTTCCHHHHHHTT-THHHHHHHTTCEE
T ss_pred CeEEEEEcCCCChhhcccCCCCeEEeCCCC---eEEecCCCCCceEEECCeecCCCCCHHHHHHHH-HHHHHHHhcCCce
Confidence 589999999999999877777777776655 3322 258999999999999999999975 8999999998
Q ss_pred ------------------CCCceeehhhhhhhhhhhhhhcccccceeE--------------------------------
Q psy5718 88 ------------------ADQYMVSVDRLRSDHQLKASTMCEHSLMHL-------------------------------- 117 (720)
Q Consensus 88 ------------------~~~~~GIIpRav~~LF~~i~~~~~~~~~~v-------------------------------- 117 (720)
+..++|||||++.+||..+........|.+
T Consensus 77 ~i~aYGqTGSGKTyTm~G~~~~~Giipr~~~~lf~~i~~~~~~~~~~v~~S~~EIyne~i~DLL~~~~~~~~~l~~~~~~ 156 (364)
T d1sdma_ 77 CIFAYGQTGSGKTFTIYGADSNPGLTPRAMSELFRIMKKDSNKFSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDS 156 (364)
T ss_dssp EEEEECSTTSSHHHHHTBCSSSBCHHHHHHHHHHHHHHHGGGTEEEEEEEEEEEESSSCEEETTSCTTSCCCCCEEEECT
T ss_pred eeeccccCCCCcccccccCccccchhHHHHHHHHhhhhhccccccceEEEEEEEEeccccccccCcccccccccceeecc
Confidence 667899999999999999987665554443
Q ss_pred ---EEecCcEEEEecChhhhHHHHHhhhccccceeccCCCCCCCceeEEEEEEEeeecCCcccccceeeeeeccCCcccc
Q psy5718 118 ---IVFPGATERFVGKPEEVFEVIEEGKANRHIAVTNMNEHSSRSHSVFLINVKQENLENEKKLSGKLYLVDLAGSEKVS 194 (720)
Q Consensus 118 ---~~V~gltev~V~S~eev~~lL~~G~~~R~~~sT~~N~~SSRSH~IftI~v~q~~~~~~~~~~skL~lVDLAGSEr~~ 194 (720)
++|+|++++.|.|+++++.+|..|..+|++++|.+|..|||||+||+|+|.+.+..+.....|+|+|||||||||..
T Consensus 157 ~~~~~v~~l~~~~v~s~~~~~~~l~~g~~~R~~~~t~~n~~ssRsH~i~~i~v~~~~~~~~~~~~~kl~~vDLAGsEr~~ 236 (364)
T d1sdma_ 157 KGMVSVENVTVVSISTYEELKTIIQRGSEQRHTTGTLMNEQSSRSHLIVSVIIESTNLQTQAIARGKLSFVDLAGSERVK 236 (364)
T ss_dssp TSCEEEETCCCEEECSHHHHHHHHHHHHHHHCCCSSCTTCHHHHSEEEEEEEEEEEETTTCCEEEEEEEEEECCCCSCCC
T ss_pred cCccccccceeeeeCCHHHHHHHhhccceeeccccccccccccccceEEEEEEEEeccCcceeeeEEEEeechhhccccc
Confidence 78999999999999999999999999999999999999999999999999999998888899999999999999999
Q ss_pred cCCCcccchHHhhhhccCCccccCc--ccccCCcccccccchhhhhhhh--------hhhccccCCcccHHHHHhHHHHH
Q psy5718 195 KTGAEGTVLDEAKNINKSLSADGAG--KLEEEFTVARLYISKMKSEVKN--------LVARCTSMESSQAEEHKKAIEYE 264 (720)
Q Consensus 195 kt~~~g~rl~E~~~INkSL~aLg~V--aL~~~~~hIPYRdSKLTrLLqd--------~mI~~iSPs~~~~~ETlsTL~fa 264 (720)
++++.|.+++|+.+||+||++||+| +|+++..|||||+||||+||+| +||+||||+..+++||++||+||
T Consensus 237 ~~~~~g~~~~E~~~iN~SL~~L~~vi~aL~~~~~~ipyR~SkLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~fa 316 (364)
T d1sdma_ 237 KSGSAGNQLKEAQSINKSLSALGDVISALSSGNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYA 316 (364)
T ss_dssp C---------CCCTTCHHHHHHHHHHHHHHHTCSCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHH
T ss_pred cccccCceeeeccccccchhhHHHHHHHHHcCCCcCCchhhhhhHHHHhhcCCCceEEEEEEeCCCcchHHHHHHHHHHH
Confidence 9999999999999999999999999 9999999999999999999999 89999999999999999999999
Q ss_pred HHhccccccchhhhHHHHHHHHHHHHHHHHHHHHHH
Q psy5718 265 KELGETRLLLQTNERREQARKDLKGLEDTVTKELQT 300 (720)
Q Consensus 265 ~rak~Ikn~~~vN~~~~~~~~~Lk~ei~~Lk~EL~~ 300 (720)
+||+.|+|.|.+|... .++..|+.++..|+.++..
T Consensus 317 ~~ak~i~n~p~~n~~~-~~~~~l~~~i~~l~~~~~~ 351 (364)
T d1sdma_ 317 SRVRSIVNDPSKNVSS-KEVARLKKLVSYWKEQAGR 351 (364)
T ss_dssp HHHTTCCCCCCCCEEC-HHHHHHHTTTTCC------
T ss_pred HHHhhcccCCcccCCH-HHHHHHHHHHHHHHHHHHh
Confidence 9999999999999744 3456677777777666543
|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|