Diaphorina citri psyllid: psy5719

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38

MKDRKRYQYEALETALKEAKEGAMKDRKRYQYEALETALKEAKEGAMKDRKRYQYEVDRIKEAVRQKNLARRGPAPQIGKGKFYLFDKVFKPNATQEKVYDEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPHVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPRIVNDIFNHIYQMDENLEFIIKVSYFEIYMDKIRDLLDVSKVNLSVHEDKNRVPFVKVKNLVARCTSMESSQAEEHKKAIEYEKELGETRLLLSHHEARMKSLQESMKEAENKKRSLEECVDALREECAKLKAAEQVTAVSSKEKAEEKEKANEVKVALEQQMDQLRDVHQKQVAELRDEIADKQSMITELKE

ccHHHHHHHHHHHHHHHHHcccccccEEcccccHHHHHHHHHHccccEEEEcccccEEEEEccEEEccccccccccccccccCEEcCEEEcccccHHHHHHHHHHHHHHHHHccccccEEEEccccccccEEcccccccccccccccccccccccEEEEEccccccccEEEcccccccccccccHHHHHHHHHHHHccccccEEEEEEEEEEEEcccccccccccccccCEEEccccccEEEEccEEEEEccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEEEEEEccccccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHcccc

************************************************DRK****************NLARRGPAPQIGKGKFYLFDKVFKPNATQEKVYDEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPHVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPRIVNDIFNHIYQMDENLEFIIKVSYFEIYMDKIRDLLDVSKVNLSVHEDKNRVPFVKVKNLVARCTSMESSQA************************ARMKSLQ*******************LREECAKLKA****************EKANEVKVALEQQMDQLR*************IADKQSMI*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKDRKRYQYEALETALKEAKEGAMKDRKRYQYEALETALKEAKEGAMKDRKRYQYEVDRIKEAVRQKNLARRGPAPQIGKGKFYLFDKVFKPNATQEKVYDEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPHVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPRIVNDIFNHIYQMDENLEFIIKVSYFEIYMDKIRDLLDVSKVNLSVHEDKNRVPFVKVKNLVARCTSMESSQAEEHKKAIEYEKELGETRLLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEQVTAVSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxITELKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005871 [CC]	kinesin complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0044707 [BP]	single-multicellular organism process	probable	GO:0032501, GO:0008150, GO:0044699
GO:0005635 [CC]	nuclear envelope	probable	GO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008574 [MF]	plus-end-directed microtubule motor activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774, GO:0003777
GO:0016043 [BP]	cellular component organization	probable	GO:0008150, GO:0071840
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007017 [BP]	microtubule-based process	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BG2, chain A
Confidence level:very confident
Coverage over the Query: 80-138,177-367
View the alignment between query and template
View the model in PyMOL

Template: 4ETP, chain A
Confidence level:very confident
Coverage over the Query: 31-136,180-367
View the alignment between query and template
View the model in PyMOL

Template: 2Y5W, chain A
Confidence level:very confident
Coverage over the Query: 81-112,151-242
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 293-360
View the alignment between query and template
View the model in PyMOL