Psyllid ID: psy5719
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 378 | 2.2.26 [Sep-21-2011] | |||||||
| P17210 | 975 | Kinesin heavy chain OS=Dr | yes | N/A | 0.328 | 0.127 | 0.685 | 2e-58 | |
| P35978 | 1031 | Kinesin heavy chain OS=St | yes | N/A | 0.335 | 0.123 | 0.626 | 2e-54 | |
| P28738 | 956 | Kinesin heavy chain isofo | yes | N/A | 0.335 | 0.132 | 0.593 | 3e-51 | |
| O60282 | 957 | Kinesin heavy chain isofo | yes | N/A | 0.335 | 0.132 | 0.593 | 3e-51 | |
| Q12840 | 1032 | Kinesin heavy chain isofo | no | N/A | 0.328 | 0.120 | 0.611 | 7e-51 | |
| Q5R9K7 | 1032 | Kinesin heavy chain isofo | yes | N/A | 0.328 | 0.120 | 0.611 | 7e-51 | |
| P33175 | 1027 | Kinesin heavy chain isofo | no | N/A | 0.328 | 0.120 | 0.611 | 7e-51 | |
| Q6QLM7 | 1027 | Kinesin heavy chain isofo | no | N/A | 0.328 | 0.120 | 0.604 | 1e-50 | |
| P21613 | 967 | Kinesin heavy chain OS=Do | N/A | N/A | 0.328 | 0.128 | 0.580 | 3e-49 | |
| P34540 | 815 | Kinesin heavy chain OS=Ca | yes | N/A | 0.328 | 0.152 | 0.598 | 3e-49 |
| >sp|P17210|KINH_DROME Kinesin heavy chain OS=Drosophila melanogaster GN=Khc PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 226 bits (577), Expect = 2e-58, Method: Compositional matrix adjust.
Identities = 111/162 (68%), Positives = 118/162 (72%), Gaps = 38/162 (23%)
Query: 81 GKFYLFDKVFKPNATQEKVYDEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVMGDP 140
GK YLFDKVFKPNA+QEKVY+EAAKSIV+DV
Sbjct: 50 GKVYLFDKVFKPNASQEKVYNEAAKSIVTDV----------------------------- 80
Query: 141 NKQGIIPHVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPRIVNDIFNHIYQMDE 200
LAGYNGTIFAYGQTSSGKTHTMEGV+GD KQGIIPRIVNDIFNHIY M+
Sbjct: 81 ---------LAGYNGTIFAYGQTSSGKTHTMEGVIGDSVKQGIIPRIVNDIFNHIYAMEV 131
Query: 201 NLEFIIKVSYFEIYMDKIRDLLDVSKVNLSVHEDKNRVPFVK 242
NLEF IKVSY+EIYMDKIRDLLDVSKVNLSVHEDKNRVP+VK
Sbjct: 132 NLEFHIKVSYYEIYMDKIRDLLDVSKVNLSVHEDKNRVPYVK 173
|
Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. Milt and Miro form an essential protein complex that links Khc to mitochondria for light chain-independent, anterograde transport of mitochondria. Drosophila melanogaster (taxid: 7227) |
| >sp|P35978|KINH_STRPU Kinesin heavy chain OS=Strongylocentrotus purpuratus PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P28738|KIF5C_MOUSE Kinesin heavy chain isoform 5C OS=Mus musculus GN=Kif5c PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|O60282|KIF5C_HUMAN Kinesin heavy chain isoform 5C OS=Homo sapiens GN=KIF5C PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q12840|KIF5A_HUMAN Kinesin heavy chain isoform 5A OS=Homo sapiens GN=KIF5A PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q5R9K7|KIF5A_PONAB Kinesin heavy chain isoform 5A OS=Pongo abelii GN=KIF5A PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P33175|KIF5A_MOUSE Kinesin heavy chain isoform 5A OS=Mus musculus GN=Kif5a PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q6QLM7|KIF5A_RAT Kinesin heavy chain isoform 5A OS=Rattus norvegicus GN=Kif5a PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P21613|KINH_DORPE Kinesin heavy chain OS=Doryteuthis pealeii PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P34540|KINH_CAEEL Kinesin heavy chain OS=Caenorhabditis elegans GN=unc-116 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 378 | ||||||
| 309384283 | 964 | kinesin heavy chain [Bombyx mori] gi|309 | 0.333 | 0.130 | 0.721 | 7e-61 | |
| 357609245 | 965 | kinesin heavy chain [Danaus plexippus] | 0.346 | 0.135 | 0.699 | 7e-61 | |
| 270014227 | 982 | kinesin heavy chain [Tribolium castaneum | 0.328 | 0.126 | 0.716 | 1e-60 | |
| 332017463 | 969 | Kinesin heavy chain [Acromyrmex echinati | 0.328 | 0.127 | 0.716 | 2e-60 | |
| 322799916 | 972 | hypothetical protein SINV_14443 [Solenop | 0.328 | 0.127 | 0.716 | 2e-60 | |
| 307186188 | 969 | Kinesin heavy chain [Camponotus floridan | 0.328 | 0.127 | 0.716 | 2e-60 | |
| 307196040 | 1002 | Kinesin heavy chain [Harpegnathos saltat | 0.328 | 0.123 | 0.716 | 2e-60 | |
| 383853868 | 970 | PREDICTED: kinesin heavy chain-like [Meg | 0.328 | 0.127 | 0.709 | 3e-60 | |
| 340721138 | 971 | PREDICTED: kinesin heavy chain-like [Bom | 0.328 | 0.127 | 0.709 | 3e-60 | |
| 189241456 | 1101 | PREDICTED: similar to Kinesin heavy chai | 0.328 | 0.112 | 0.716 | 4e-60 |
| >gi|309384283|ref|NP_001116822.2| kinesin heavy chain [Bombyx mori] gi|309378082|gb|ABK92268.2| kinesin-like protein 1 [Bombyx mori] | Back alignment and taxonomy information |
|---|
Score = 240 bits (613), Expect = 7e-61, Method: Compositional matrix adjust.
Identities = 119/165 (72%), Positives = 122/165 (73%), Gaps = 39/165 (23%)
Query: 78 IGKGKFYLFDKVFKPNATQEKVYDEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVM 137
IG GK YLFDKVFKPNATQEKVY+EAAKSIVSDV
Sbjct: 48 IG-GKVYLFDKVFKPNATQEKVYNEAAKSIVSDV-------------------------- 80
Query: 138 GDPNKQGIIPHVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPRIVNDIFNHIYQ 197
LAGYNGTIFAYGQTSSGKTHTMEGV+GDP KQGIIPRIVNDIFNHIY
Sbjct: 81 ------------LAGYNGTIFAYGQTSSGKTHTMEGVIGDPGKQGIIPRIVNDIFNHIYA 128
Query: 198 MDENLEFIIKVSYFEIYMDKIRDLLDVSKVNLSVHEDKNRVPFVK 242
M+ENLEF IKVSYFEIYMDKIRDLLDVSKVNLSVHEDKNRVPFVK
Sbjct: 129 MEENLEFHIKVSYFEIYMDKIRDLLDVSKVNLSVHEDKNRVPFVK 173
|
Source: Bombyx mori Species: Bombyx mori Genus: Bombyx Family: Bombycidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357609245|gb|EHJ66362.1| kinesin heavy chain [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|270014227|gb|EFA10675.1| kinesin heavy chain [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|332017463|gb|EGI58186.1| Kinesin heavy chain [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|322799916|gb|EFZ21057.1| hypothetical protein SINV_14443 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307186188|gb|EFN71894.1| Kinesin heavy chain [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307196040|gb|EFN77765.1| Kinesin heavy chain [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383853868|ref|XP_003702444.1| PREDICTED: kinesin heavy chain-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340721138|ref|XP_003398982.1| PREDICTED: kinesin heavy chain-like [Bombus terrestris] gi|350399421|ref|XP_003485517.1| PREDICTED: kinesin heavy chain-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|189241456|ref|XP_973415.2| PREDICTED: similar to Kinesin heavy chain CG7765-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 378 | ||||||
| UNIPROTKB|F1RWC5 | 960 | KIF5B "Uncharacterized protein | 0.320 | 0.126 | 0.707 | 5.2e-65 | |
| UNIPROTKB|F1N1G7 | 963 | KIF5B "Uncharacterized protein | 0.320 | 0.125 | 0.707 | 6.8e-65 | |
| UNIPROTKB|E2QTN0 | 963 | KIF5B "Uncharacterized protein | 0.320 | 0.125 | 0.707 | 6.8e-65 | |
| UNIPROTKB|P33176 | 963 | KIF5B "Kinesin-1 heavy chain" | 0.320 | 0.125 | 0.707 | 6.8e-65 | |
| RGD|621559 | 963 | Kif5b "kinesin family member 5 | 0.320 | 0.125 | 0.707 | 8.6e-65 | |
| MGI|MGI:1098268 | 963 | Kif5b "kinesin family member 5 | 0.320 | 0.125 | 0.707 | 8.6e-65 | |
| FB|FBgn0001308 | 975 | Khc "Kinesin heavy chain" [Dro | 0.537 | 0.208 | 0.493 | 6e-43 | |
| UNIPROTKB|E1C3A1 | 966 | KIF5B "Uncharacterized protein | 0.396 | 0.155 | 0.594 | 2e-41 | |
| UNIPROTKB|O60282 | 957 | KIF5C "Kinesin heavy chain iso | 0.478 | 0.189 | 0.530 | 2.2e-39 | |
| UNIPROTKB|F1SKH3 | 956 | KIF5A "Uncharacterized protein | 0.447 | 0.176 | 0.562 | 4e-42 |
| UNIPROTKB|F1RWC5 KIF5B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 430 (156.4 bits), Expect = 5.2e-65, Sum P(2) = 5.2e-65
Identities = 87/123 (70%), Positives = 97/123 (78%)
Query: 120 FAYGQTSSGKTHTMEGVMGDPNKQGIIPHVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPN 179
+A+ + T + E V D K+ I+ VL GYNGTIFAYGQTSSGKTHTMEG + DP
Sbjct: 43 YAFDRVFQSST-SQEQVYNDCAKK-IVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPE 100
Query: 180 KQGIIPRIVNDIFNHIYQMDENLEFIIKVSYFEIYMDKIRDLLDVSKVNLSVHEDKNRVP 239
GIIPRIV DIFN+IY MDENLEF IKVSYFEIY+DKIRDLLDVSK NLSVHEDKNRVP
Sbjct: 101 GMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVP 160
Query: 240 FVK 242
+VK
Sbjct: 161 YVK 163
|
|
| UNIPROTKB|F1N1G7 KIF5B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QTN0 KIF5B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P33176 KIF5B "Kinesin-1 heavy chain" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|621559 Kif5b "kinesin family member 5B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1098268 Kif5b "kinesin family member 5B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0001308 Khc "Kinesin heavy chain" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C3A1 KIF5B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60282 KIF5C "Kinesin heavy chain isoform 5C" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SKH3 KIF5A "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 378 | |||
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 3e-70 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 1e-47 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 3e-46 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 1e-43 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 5e-41 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 1e-34 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 2e-33 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 2e-33 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 6e-31 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 3e-28 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 1e-27 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 4e-27 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 2e-25 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 7e-24 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 1e-23 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 2e-23 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 8e-23 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 1e-14 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 3e-14 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 3e-12 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.002 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.004 | |
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 0.004 |
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
Score = 222 bits (569), Expect = 3e-70
Identities = 91/163 (55%), Positives = 100/163 (61%), Gaps = 38/163 (23%)
Query: 80 KGKFYLFDKVFKPNATQEKVYDEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVMGD 139
GK + FD+VF PN TQE VY+ AK IV DVL GYNGTIF
Sbjct: 41 DGKTFSFDRVFPPNTTQEDVYNFVAKPIVDDVLNGYNGTIF------------------- 81
Query: 140 PNKQGIIPHVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPRIVNDIFNHIYQMD 199
AYGQT SGKT+TMEG GDP +GIIPRIV+DIF HI MD
Sbjct: 82 -------------------AYGQTGSGKTYTMEGPPGDPELKGIIPRIVHDIFEHISSMD 122
Query: 200 ENLEFIIKVSYFEIYMDKIRDLLDVSKVNLSVHEDKNRVPFVK 242
ENLEF +KVSY EIYM+KIRDLLDVSK NL VHEDKNR +VK
Sbjct: 123 ENLEFHVKVSYLEIYMEKIRDLLDVSKDNLQVHEDKNRGVYVK 165
|
Members of this group have been associated with organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 325 |
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 378 | |||
| KOG4280|consensus | 574 | 100.0 | ||
| KOG0245|consensus | 1221 | 100.0 | ||
| KOG0239|consensus | 670 | 100.0 | ||
| KOG0240|consensus | 607 | 100.0 | ||
| KOG0242|consensus | 675 | 100.0 | ||
| KOG0243|consensus | 1041 | 100.0 | ||
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 100.0 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 100.0 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 100.0 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 100.0 | |
| KOG0247|consensus | 809 | 100.0 | ||
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 100.0 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 100.0 | |
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 100.0 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 100.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 100.0 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 100.0 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 100.0 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 100.0 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 100.0 | |
| KOG0241|consensus | 1714 | 100.0 | ||
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 100.0 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 100.0 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 100.0 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 100.0 | |
| KOG0244|consensus | 913 | 100.0 | ||
| KOG0246|consensus | 676 | 100.0 | ||
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 99.96 | |
| KOG0243|consensus | 1041 | 98.86 | ||
| KOG4280|consensus | 574 | 98.72 | ||
| KOG0239|consensus | 670 | 98.7 | ||
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 98.56 | |
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 98.5 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 98.47 | |
| KOG0241|consensus | 1714 | 98.37 | ||
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 98.28 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 98.27 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 98.27 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 98.2 | |
| KOG0242|consensus | 675 | 98.18 | ||
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 98.18 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 98.17 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 98.15 | |
| KOG0240|consensus | 607 | 98.13 | ||
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 98.11 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 98.04 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 98.04 | |
| KOG0247|consensus | 809 | 97.95 | ||
| KOG0245|consensus | 1221 | 97.95 | ||
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 97.92 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 97.87 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 97.8 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 97.69 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 97.62 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 97.62 | |
| KOG0246|consensus | 676 | 97.41 | ||
| KOG0244|consensus | 913 | 95.88 | ||
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 95.21 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 93.93 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 93.21 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 92.58 | |
| PRK08116 | 268 | hypothetical protein; Validated | 90.84 | |
| PRK06620 | 214 | hypothetical protein; Validated | 89.71 | |
| PRK12377 | 248 | putative replication protein; Provisional | 89.56 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 89.32 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 89.28 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 89.1 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 88.7 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 88.5 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 87.96 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 87.72 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 87.67 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 87.64 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 87.44 | |
| PRK09087 | 226 | hypothetical protein; Validated | 87.24 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 87.01 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 86.64 | |
| PRK06526 | 254 | transposase; Provisional | 86.18 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 86.08 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 85.77 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 85.64 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 85.42 | |
| PRK08181 | 269 | transposase; Validated | 85.08 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 84.65 | |
| KOG0989|consensus | 346 | 84.31 | ||
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 84.3 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 84.26 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 84.21 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 83.08 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 82.9 | |
| PRK08727 | 233 | hypothetical protein; Validated | 82.51 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 82.2 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 82.14 | |
| COG5008 | 375 | PilU Tfp pilus assembly protein, ATPase PilU [Cell | 81.34 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 81.07 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 80.63 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 80.28 |
| >KOG4280|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.4e-62 Score=491.15 Aligned_cols=236 Identities=34% Similarity=0.494 Sum_probs=215.0
Q ss_pred CCCeeEecccccCCCCChHHHHHHHHHHHHHHhhccCCcceeeeccCCCCcceEecccCCCCCCCCchhhhhhcccCccc
Q psy5719 79 GKGKFYLFDKVFKPNATQEKVYDEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPHVLAGYNGTIF 158 (378)
Q Consensus 79 ~~~~~F~FD~Vf~~~~~Q~~vf~~~~~~lv~~~l~G~n~~i~ayG~tgSGKTyTm~G~~~~~~~~gil~r~l~g~~~~i~ 158 (378)
+.++.|+||.||+++++|++||+.++.|+|++|++|||+||||||||||||||||+|.
T Consensus 49 ~~~~~ftfD~vf~~~stQ~dvy~~~~~~lV~svl~GyNgtvFaYGQTGsGKTyTM~G~---------------------- 106 (574)
T KOG4280|consen 49 GKPKSFTFDAVFDSDSTQDDVYQETVAPLVESVLEGYNGTVFAYGQTGSGKTYTMIGP---------------------- 106 (574)
T ss_pred CCCCCceeeeeecCCCCHHHHHHHHhHHHHHHHhcccCceEEEeccCCCCCceEeeCC----------------------
Confidence 4567799999999999999999999999999999999999999999999999999985
Q ss_pred cccCCCCCCcccccccCCCCCCCCchhhhHHHHHhhhhcccccceeEEEEeeeeeecccccccccccc-CCCcccccCCC
Q psy5719 159 AYGQTSSGKTHTMEGVMGDPNKQGIIPRIVNDIFNHIYQMDENLEFIIKVSYFEIYMDKIRDLLDVSK-VNLSVHEDKNR 237 (378)
Q Consensus 159 aygqtgsgKt~tm~g~~~~~~~~Giipr~~~~lf~~l~~~~~~~~~~V~vS~~EIYnE~i~DLL~~~~-~~L~i~ed~~~ 237 (378)
++..+|||||++.+||..|........|.|.|||+|||||.|+|||++.. ..|.+++|+..
T Consensus 107 ------------------~~~~~GiiPraf~~LF~~I~~~~~~~~f~vrvS~lEiYnE~i~DLL~~~~~~~l~lre~p~~ 168 (574)
T KOG4280|consen 107 ------------------DPELRGLIPRAFEHLFRHIDERKEKTRFLVRVSYLEIYNESIRDLLSPVNPKGLELREDPKC 168 (574)
T ss_pred ------------------ChhhCCchhHHHHHHHHHHHhccccceEEEEeehHHHHhHHHHHHhCccCcCCceeeEcCCC
Confidence 13667999999999999999877677999999999999999999999876 68999999999
Q ss_pred CcEEeeeceeeeecccccCCHHHHHHHHHHH---HHhhhhhcc----chhhHHHHhhhhhh--hhhhccccchHHHHHHh
Q psy5719 238 VPFVKVKNLVARCTSMESSQAEEHKKAIEYE---KELGETRLL----LSHHEARMKSLQES--MKEAENKKRSLEECVDA 308 (378)
Q Consensus 238 ~~~v~~~~~v~~~T~~~v~Ss~~~~~ll~~g---r~~~~t~ln----rSH~if~i~~~~~~--l~e~~~in~Sll~lVDL 308 (378)
|+|| .+++++.+.|+++++.++..| |+++.|.|| |||+||++++.... ......+..|+||||||
T Consensus 169 Gv~V------~nlse~~v~s~~d~~~~l~~G~~nR~vgat~mn~~SsRSH~ift~~i~~~~~~~~~~~~~~~~rlnlvDL 242 (574)
T KOG4280|consen 169 GVYV------ENLSEMDVESAEDAQQLLVVGLANRRVGATSMNEESSRSHAIFTIHIESSEKSDGGLMSGRSSKLNLVDL 242 (574)
T ss_pred ceEe------cCcceeecCCHHHHHHHHHHHHhhcchhhccCCcccccceEEEEEEEEeecccCCCccccccceeeeeec
Confidence 9999 799999999999999999988 999999999 99999999977622 33444588899999999
Q ss_pred hcccchhhhhhhhhhhcchhhhHHHHhhHHHHHHHHHHHHHHHHHHhhhhhhhhhhHHHH
Q psy5719 309 LREECAKLKAAEQVTAVSSKEKAEEKEKANEVKVALEQQMDQLRDVHQKQVAELRDEIAD 368 (378)
Q Consensus 309 AGSEra~~~~~e~~~~~~~~~rl~E~~~IN~SLs~Lg~vi~aL~~~~~~~~~~~~d~~~~ 368 (378)
||||| ..++++.| +|+|||.+||+|||+||+||++|++.... |++|||+-+.
T Consensus 243 agsEr-----~~~tga~G--~rlkEa~~IN~SLs~LG~vI~aLvd~~~~-HIPYRdSkLT 294 (574)
T KOG4280|consen 243 AGSER-----QSKTGAEG--ERLKEATNINLSLSALGNVISALVDGSKT-HIPYRDSKLT 294 (574)
T ss_pred cchhh-----hcccCccc--hhhhhhcccchhHHHHHHHHHHHhccccC-CCCcchhHHH
Confidence 99999 77777777 99999999999999999999999999876 9999999654
|
|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >KOG0240|consensus | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >KOG0240|consensus | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 378 | ||||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 3e-57 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 2e-49 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 5e-47 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 6e-47 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 2e-46 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 1e-25 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-21 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-18 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-18 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 2e-16 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 4e-16 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 5e-16 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 5e-16 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 5e-16 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 5e-16 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 5e-16 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 6e-16 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 7e-16 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 7e-16 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 8e-16 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 9e-16 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 9e-16 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-15 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-15 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 1e-15 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 9e-14 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 1e-13 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 1e-13 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 1e-13 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-13 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 3e-13 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 3e-13 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 3e-13 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 4e-13 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 3e-12 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 4e-12 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 1e-11 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 7e-11 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 1e-10 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 1e-10 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 2e-10 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 2e-10 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 2e-10 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 3e-10 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 3e-09 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 4e-09 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 4e-09 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 4e-09 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 4e-09 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 4e-09 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 4e-09 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 9e-09 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 1e-08 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 8e-08 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 1e-08 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 5e-07 | ||
| 1ry6_A | 360 | Crystal Structure Of Internal Kinesin Motor Domain | 6e-07 |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
|
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
Score = 199 bits (509), Expect = 2e-61
Identities = 95/166 (57%), Positives = 107/166 (64%), Gaps = 38/166 (22%)
Query: 77 QIGKGKFYLFDKVFKPNATQEKVYDEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGV 136
+ K Y FD+VF+ + +QE+VY++ AK IV DVL GYNGTIF
Sbjct: 39 VVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIF---------------- 82
Query: 137 MGDPNKQGIIPHVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPRIVNDIFNHIY 196
AYGQTSSGKTHTMEG + DP GIIPRIV DIFN+IY
Sbjct: 83 ----------------------AYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY 120
Query: 197 QMDENLEFIIKVSYFEIYMDKIRDLLDVSKVNLSVHEDKNRVPFVK 242
MDENLEF IKVSYFEIY+DKIRDLLDVSK NLSVHEDKNRVP+VK
Sbjct: 121 SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVK 166
|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 378 | |||
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 100.0 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 100.0 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 100.0 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 100.0 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 100.0 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 100.0 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 100.0 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 100.0 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 100.0 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 100.0 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 100.0 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 100.0 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 100.0 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 100.0 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 100.0 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 100.0 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 100.0 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 100.0 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 100.0 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 100.0 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 100.0 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 100.0 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 100.0 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 100.0 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 100.0 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 100.0 | |
| 2o0a_A | 298 | S.cerevisiae chromosome XVI reading frame ORF YPL2 | 99.92 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 98.77 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 98.73 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 98.73 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 98.66 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 98.65 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 98.64 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 98.64 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 98.64 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 98.64 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 98.64 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 98.64 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 98.63 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 98.58 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 98.56 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 98.56 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 98.56 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 98.55 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 98.54 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 98.53 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 98.49 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 98.41 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 98.23 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 98.22 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 98.14 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 98.01 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 97.95 | |
| 4etp_B | 333 | Spindle POLE BODY-associated protein VIK1; kinesin | 97.74 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 97.65 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 97.57 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 97.52 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 95.89 | |
| 2o0a_A | 298 | S.cerevisiae chromosome XVI reading frame ORF YPL2 | 94.55 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 94.24 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 92.14 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 91.68 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 87.64 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 87.03 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 86.53 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 86.49 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 85.99 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 85.89 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 85.01 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 84.87 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 84.59 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 84.41 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 84.21 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 83.72 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 82.39 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 81.72 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 81.71 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 80.76 |
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.5e-61 Score=478.50 Aligned_cols=302 Identities=24% Similarity=0.323 Sum_probs=237.7
Q ss_pred hHHHHHHHHHHHHhh-hhHHhhhhhHHHHHHHHHHHHHHHhHhhhhhhHHHHhhhcceec----cccccC-CCC------
Q psy5719 8 QYEALETALKEAKEG-AMKDRKRYQYEALETALKEAKEGAMKDRKRYQYEVDRIKEAVRQ----KNLARR-GPA------ 75 (378)
Q Consensus 8 ~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~-~~~------ 75 (378)
+.++++..++.+++. +..++...+.++--..+++.+..+...|++++|++.++|++||| +|+... +..
T Consensus 4 ~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~rr~l~n~~~elkgnIrV~vRvRP~~~~~e~~~~~~~~ 83 (403)
T 4etp_A 4 KIAALKEKIAALKEKIAALKEKIKDTELGMKELNEILIKEETVRRTLHNELQELRGNIRVYLRIRPALKNLENSDTSLIN 83 (403)
T ss_dssp -CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSEEEEEEECCCCTTTSCSCCTTEE
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCeEEEEEeCCCCCcccccCCCeeE
Confidence 346777778777777 66666666655555556666777799999999999998887776 554322 100
Q ss_pred -----C-------------cCCCCeeEecccccCCCCChHHHHHHHHHHHHHHhhccCCcceeeeccCCCCcceEecccC
Q psy5719 76 -----P-------------QIGKGKFYLFDKVFKPNATQEKVYDEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVM 137 (378)
Q Consensus 76 -----~-------------~~~~~~~F~FD~Vf~~~~~Q~~vf~~~~~~lv~~~l~G~n~~i~ayG~tgSGKTyTm~G~~ 137 (378)
. .....+.|+||+||+|+++|++||+. +.|+|+++++|||+||||||||||||||||+|+
T Consensus 84 v~~~~~~~~~~~~~~~~~~~~~~~~~F~FD~VF~~~~~Q~~Vf~~-v~~lv~~~l~G~N~tifAYGqTGSGKTyTM~g~- 161 (403)
T 4etp_A 84 VNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKE-VGQLVQSSLDGYNVAIFAYGQTGSGKTFTMLNP- 161 (403)
T ss_dssp ECCCBTTTTBEEEEEEECSSSCEEEEEEESEEECTTCCHHHHHHH-HHHHHHHHHTTCCEEEEEESCTTSSHHHHHHCT-
T ss_pred EeeccCCCCceEEEEecCCCCcCceEEEcCEEECCCCchHHHHHH-HHHHHHHHhCCcceEEEEECCCCCCCceEeCCC-
Confidence 0 01123689999999999999999998 569999999999999999999999999999873
Q ss_pred CCCCCCCchhhhhhcccCccccccCCCCCCcccccccCCCCCCCCchhhhHHHHHhhhhcc-cccceeEEEEeeeeeecc
Q psy5719 138 GDPNKQGIIPHVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPRIVNDIFNHIYQM-DENLEFIIKVSYFEIYMD 216 (378)
Q Consensus 138 ~~~~~~gil~r~l~g~~~~i~aygqtgsgKt~tm~g~~~~~~~~Giipr~~~~lf~~l~~~-~~~~~~~V~vS~~EIYnE 216 (378)
..||+||++.+||..+... ...+.|.|++||+|||||
T Consensus 162 ------------------------------------------~~Giipr~~~~lF~~i~~~~~~~~~~~v~vS~~EIYnE 199 (403)
T 4etp_A 162 ------------------------------------------GDGIIPSTISHIFNWINKLKTKGWDYKVNAEFIEIYNE 199 (403)
T ss_dssp ------------------------------------------TTSHHHHHHHHHHHHHHHHHTTTEEEEEEEEEEEEETT
T ss_pred ------------------------------------------CCccchhHHHHHHHHHHhhhccCceEEEEEEEEEEecc
Confidence 2399999999999998763 457899999999999999
Q ss_pred cccccccccc---------CCCcccccC-CCCcEEeeeceeeeecccccCCHHHHHHHHHHH---HHhhhhhcc----ch
Q psy5719 217 KIRDLLDVSK---------VNLSVHEDK-NRVPFVKVKNLVARCTSMESSQAEEHKKAIEYE---KELGETRLL----LS 279 (378)
Q Consensus 217 ~i~DLL~~~~---------~~L~i~ed~-~~~~~v~~~~~v~~~T~~~v~Ss~~~~~ll~~g---r~~~~t~ln----rS 279 (378)
.|+|||.+.. ..+.+++++ .++++| .+++++.+.|.++++.++..| |+++.|.|| ||
T Consensus 200 ~i~DLL~~~~~~~~~~~~~~~~~i~~~~~~~~~~v------~~l~~~~v~s~~e~~~ll~~g~~~R~~~~T~~N~~SSRS 273 (403)
T 4etp_A 200 NIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTI------TNVTSVKLESEEMVEIILKKANKLRSTASTASNEHSSRS 273 (403)
T ss_dssp EEEETTCC--------CCSCCCCEEEETTTTEEEE------TTCCCEECCCHHHHHHHHHHHC--C----CHHHHHHHTS
T ss_pred eeeEccCCccccccccccCcceeeEEeCCCCCEEe------cCcEEEEeCCHHHHHHHHHHHHHhcccccccCCcccCCc
Confidence 9999998653 346677765 455777 799999999999999999988 999999998 99
Q ss_pred hhHHHHhhhhhhhhhhccccchHHHHHHhhcccchhhhhhhhhhhcchhhhHHHHhhHHHHHHHHHHHHHHHHHHhh-hh
Q psy5719 280 HHEARMKSLQESMKEAENKKRSLEECVDALREECAKLKAAEQVTAVSSKEKAEEKEKANEVKVALEQQMDQLRDVHQ-KQ 358 (378)
Q Consensus 280 H~if~i~~~~~~l~e~~~in~Sll~lVDLAGSEra~~~~~e~~~~~~~~~rl~E~~~IN~SLs~Lg~vi~aL~~~~~-~~ 358 (378)
|+||+++..+.... .+....|+|+||||||||| ..++++.| +|++|+++||+||++||+||.||++... ++
T Consensus 274 H~if~i~v~~~~~~-~~~~~~~kL~lVDLAGSEr-----~~~t~~~g--~rl~E~~~INkSL~aLg~vI~aL~~~~~~~~ 345 (403)
T 4etp_A 274 HSIFIIHLSGSNAK-TGAHSYGTLNLVDLAGSER-----INVSQVVG--DRLRETQNINKSLSALGDVIHALGQPDSTKR 345 (403)
T ss_dssp EEEEEEEEEEEETT-TCCEEEEEEEEEECCCCCC-----CCCSSCCH--HHHHHHHHHHHHHHHHHHHHHHHTSSCTTTS
T ss_pred ccEEEEEEEEeecC-CCCeeEEEEEEEECCCCcc-----ccccCChh--HHHHHHHHHHHHHHHHHHHHHHHhcccCCCC
Confidence 99999986544322 2224567899999999999 44455555 9999999999999999999999987653 45
Q ss_pred hhhhhhHHH
Q psy5719 359 VAELRDEIA 367 (378)
Q Consensus 359 ~~~~~d~~~ 367 (378)
+.|+||+-+
T Consensus 346 hiPyRdSkL 354 (403)
T 4etp_A 346 HIPFRNSKL 354 (403)
T ss_dssp CCCGGGSHH
T ss_pred cCCcccchH
Confidence 899999864
|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4etp_B Spindle POLE BODY-associated protein VIK1; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 378 | ||||
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 2e-24 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 2e-20 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 4e-20 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 7e-20 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 2e-13 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 6e-13 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 3e-12 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 7e-11 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 2e-10 |
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Human (Homo sapiens) [TaxId: 9606]
Score = 99 bits (248), Expect = 2e-24
Identities = 103/238 (43%), Positives = 125/238 (52%), Gaps = 38/238 (15%)
Query: 78 IGKGKFYLFDKVFKPNATQEKVYDEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVM 137
+ K Y FD+VF+ + +QE+VY++ AK IV
Sbjct: 38 VIASKPYAFDRVFQSSTSQEQVYNDCAKKIVK---------------------------- 69
Query: 138 GDPNKQGIIPHVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPRIVNDIFNHIYQ 197
VL GYNGTIFAYGQTSSGKTHTMEG + DP GIIPRIV DIFN+IY
Sbjct: 70 ----------DVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIYS 119
Query: 198 MDENLEFIIKVSYFEIYMDKIRDLLDVSKVNLSVHEDKNRVPFVKVKNLVARCTSMESSQ 257
MDENLEF IKVSYFEIY+DKIRDLLDVSK NLSVHEDKNRVP+VK C+ E
Sbjct: 120 MDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVMD 179
Query: 258 AEEHKKAIEYEKELGETRLLLSHHEARMKSLQESMKEAENKKRSLEECVDALREECAK 315
+ K+ + H + ++++ + E K VD E
Sbjct: 180 TIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVS 237
|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 378 | |||
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 100.0 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 100.0 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 100.0 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 100.0 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 100.0 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 100.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 100.0 | |
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 98.47 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 98.39 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 98.31 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 98.31 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 98.21 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 98.17 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 97.84 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 97.55 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 97.44 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 94.1 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.45 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 92.38 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 87.94 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 86.46 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 85.13 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 83.96 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 83.14 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 82.71 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 81.96 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 81.73 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 81.57 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 81.43 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 80.59 |
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin heavy chain-like protein species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=100.00 E-value=1.5e-53 Score=418.56 Aligned_cols=230 Identities=27% Similarity=0.393 Sum_probs=195.7
Q ss_pred CCeeEecccccCCCCChHHHHHHHHHHHHHHhhccCCcceeeeccCCCCcceEecccCCCCCCCCchhhhhhcccCcccc
Q psy5719 80 KGKFYLFDKVFKPNATQEKVYDEAAKSIVSDVLAGYNGTIFAYGQTSSGKTHTMEGVMGDPNKQGIIPHVLAGYNGTIFA 159 (378)
Q Consensus 80 ~~~~F~FD~Vf~~~~~Q~~vf~~~~~~lv~~~l~G~n~~i~ayG~tgSGKTyTm~G~~~~~~~~gil~r~l~g~~~~i~a 159 (378)
.++.|+||+||+++++|++||+. +.|+|+++++|+|+||||||||||||||||+|..
T Consensus 40 ~~~~f~FD~vf~~~~~q~~vy~~-v~~lv~~~l~G~n~~i~aYGqTGSGKTyTm~G~~---------------------- 96 (364)
T d1sdma_ 40 KAKQHMYDRVFDGNATQDDVFED-TKYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGAD---------------------- 96 (364)
T ss_dssp SEEEEECSEEECTTCCHHHHHHT-TTHHHHHHHTTCEEEEEEECSTTSSHHHHHTBCS----------------------
T ss_pred CceEEECCeecCCCCCHHHHHHH-HHHHHHHHhcCCceeeeccccCCCCcccccccCc----------------------
Confidence 56899999999999999999997 5899999999999999999999999999999863
Q ss_pred ccCCCCCCcccccccCCCCCCCCchhhhHHHHHhhhhcccccceeEEEEeeeeeecccccccccccc---CCCcccccCC
Q psy5719 160 YGQTSSGKTHTMEGVMGDPNKQGIIPRIVNDIFNHIYQMDENLEFIIKVSYFEIYMDKIRDLLDVSK---VNLSVHEDKN 236 (378)
Q Consensus 160 ygqtgsgKt~tm~g~~~~~~~~Giipr~~~~lf~~l~~~~~~~~~~V~vS~~EIYnE~i~DLL~~~~---~~L~i~ed~~ 236 (378)
..+||+||++.+||+.+........|.|++||+|||||.++|||.+.. ..+.+++|+.
T Consensus 97 -------------------~~~Giipr~~~~lf~~i~~~~~~~~~~v~~S~~EIyne~i~DLL~~~~~~~~~l~~~~~~~ 157 (364)
T d1sdma_ 97 -------------------SNPGLTPRAMSELFRIMKKDSNKFSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDSK 157 (364)
T ss_dssp -------------------SSBCHHHHHHHHHHHHHHHGGGTEEEEEEEEEEEESSSCEEETTSCTTSCCCCCEEEECTT
T ss_pred -------------------cccchhHHHHHHHHhhhhhccccccceEEEEEEEEeccccccccCcccccccccceeeccc
Confidence 334999999999999998888889999999999999999999998753 4678899999
Q ss_pred CCcEEeeeceeeeecccccCCHHHHHHHHHHH---HHhhhhhcc----chhhHHHHhhhhhhhhhhccccchHHHHHHhh
Q psy5719 237 RVPFVKVKNLVARCTSMESSQAEEHKKAIEYE---KELGETRLL----LSHHEARMKSLQESMKEAENKKRSLEECVDAL 309 (378)
Q Consensus 237 ~~~~v~~~~~v~~~T~~~v~Ss~~~~~ll~~g---r~~~~t~ln----rSH~if~i~~~~~~l~e~~~in~Sll~lVDLA 309 (378)
++++| .+++++.+.|..+++.++..| |+++.|.+| |||+||++....... ....+..|+++|||||
T Consensus 158 ~~~~v------~~l~~~~v~s~~~~~~~l~~g~~~R~~~~t~~n~~ssRsH~i~~i~v~~~~~-~~~~~~~~kl~~vDLA 230 (364)
T d1sdma_ 158 GMVSV------ENVTVVSISTYEELKTIIQRGSEQRHTTGTLMNEQSSRSHLIVSVIIESTNL-QTQAIARGKLSFVDLA 230 (364)
T ss_dssp SCEEE------ETCCCEEECSHHHHHHHHHHHHHHHCCCSSCTTCHHHHSEEEEEEEEEEEET-TTCCEEEEEEEEEECC
T ss_pred Ccccc------ccceeeeeCCHHHHHHHhhccceeeccccccccccccccceEEEEEEEEecc-CcceeeeEEEEeechh
Confidence 99998 799999999999999999987 899999988 999999988554333 2334667889999999
Q ss_pred cccchhhhhhhhhhhcchhhhHHHHhhHHHHHHHHHHHHHHHHHHhhhhhhhhhhHHH
Q psy5719 310 REECAKLKAAEQVTAVSSKEKAEEKEKANEVKVALEQQMDQLRDVHQKQVAELRDEIA 367 (378)
Q Consensus 310 GSEra~~~~~e~~~~~~~~~rl~E~~~IN~SLs~Lg~vi~aL~~~~~~~~~~~~d~~~ 367 (378)
|||| ...+++.| ++++|+.+||+||++||+||.+|+. .+++.++||+-+
T Consensus 231 GsEr-----~~~~~~~g--~~~~E~~~iN~SL~~L~~vi~aL~~--~~~~ipyR~SkL 279 (364)
T d1sdma_ 231 GSER-----VKKSGSAG--NQLKEAQSINKSLSALGDVISALSS--GNQHIPYRNHKL 279 (364)
T ss_dssp CCSC-----CCC-----------CCCTTCHHHHHHHHHHHHHHH--TCSCCCGGGCHH
T ss_pred hccc-----cccccccC--ceeeeccccccchhhHHHHHHHHHc--CCCcCCchhhhh
Confidence 9999 44444455 9999999999999999999999987 457899999853
|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|