Diaphorina citri psyllid: psy571


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MASPFIGATDSAVPCAMLLYIARLMRQELSQLNQNLGLDLIFFDGEEAFNEWSAEDSIWGARHLAAKWERSHLQHRGKTLTKLDRMDMLVLLDLLGTSNPRFYSYYPPTHKWYKQLVGIESRLTAQGLLNMVNSNRSKKLTYFREMSTFPVAEDDHLPFYYR
cccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccccHHHcccccccccccccccccccccccccccccc
****FIGATDSAVPCAMLLYIARLMRQELSQLNQNLGLDLIFFDGEEAFNEWSAEDSIWGARHLAAKWERSHLQHRGKTLTKLDRMDMLVLLDLLGTSNPRFYSYYPPTHKWYKQLVGIESRLTAQGLLNMVNSNRSKKLTYFREMSTFPVAEDDHLPFYYR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASPFIGATDSAVPCAMLLYIARLMRQELSQLNQNLGLDLIFFDGEEAFNEWSAEDSIWGARHLAAKWERSHLQHRGKTLTKLDRMDMLVLLDLLGTSNPRFYSYYPPTHKWYKQLVGIESRLTAQGLLNMVNSNRSKKLTYFREMSTFPVAEDDHLPFYYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0017186 [BP]peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferaseprobableGO:0044267, GO:0018199, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152
GO:0016603 [MF]glutaminyl-peptide cyclotransferase activityprobableGO:0016746, GO:0016740, GO:0016755, GO:0003674, GO:0003824
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005575 [CC]cellular_componentprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F9U, chain A
Confidence level:very confident
Coverage over the Query: 3-162
View the alignment between query and template
View the model in PyMOL