Diaphorina citri psyllid: psy5731


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MWLTAVRTKWKRQTAVGLELLAEAGNYAAFQRLYGGPTYGCWPYQGGGTTQPSAADLYYRQAAVAAAAVSTLQKPLAYRLYPGVPATANASHSLSPPGLAATSLSSISSYYNNLNLTRSCSPDNAMGGSRGSHTPDSQPESVDVEESSNDSPSNNKIDV
cccccccHHHHHHHHHHHHHHHHHcccHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MWLTAVRTKWKRQTAVGLELLAEAGNYAAFQRLYGGPTYGCWPYQGGGTTQPSAADLYYRQAAVAAAAVSTLQKPLAYRLYPGVPA************************Y************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWLTAVRTKWKRQTAVGLELLAEAGNYAAFQRLYGGPTYGCWPYQGGGTTQPSAADLYYRQAAVAAAAVSTLQKPLAYRLYPGVPATANASHSLSPPGLAATSLSSISSYYNNLNLTRSCSPDNAMGGSRGSHTPDSQPESVDVEESSNDSPSNNKIDV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox protein B-H2 B-H1 and B-H2 are regulated by members of the wg signaling pathway; wg and dpp. B-H1 and B-H2 are coexpressed and functionally required in R1 and R6 receptor cells and primary pigment cells for normal eye development. Coexpression is also required for the fate determination of external sensory organs, formation of notal microchaetae, formation of presutural macrochaetae, antennal development and for distal leg morphogenesis; segmentation and specification of tarsal segments 3-5.confidentQ24256

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0000981 [MF]sequence-specific DNA binding RNA polymerase II transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0032502 [BP]developmental processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A01, chain A
Confidence level:probable
Coverage over the Query: 1-17
View the alignment between query and template
View the model in PyMOL