Diaphorina citri psyllid: psy5750


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
GVFNYSAELIFSTGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHSSTVNDDPCKNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMYLEVVNIQEICGENSISGL
ccccccEEEEEccccEEECcccccCCccccccccccccccccccccccccccccccccccccccccccccccccccccccEEECcccccEEEcccccccccccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccEECccccccccccccccccccccccccEEECccccEEEEccccccccccccccccccccccccccccccccccccEEECccccEEEEccccccccccccccccccccccccccccccEEEcccccccccccccc
GVFNYSAELIFSTGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHSSTVNDDPCKNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMYLEVVNIQEICGENSISGL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GVFNYSAELIFSTGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHSSTVNDDPCKNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMYLEVVNIQEICGENSISGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044424 [CC]intracellular partprobableGO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0043226 [CC]organelleprobableGO:0005575
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UZK, chain A
Confidence level:very confident
Coverage over the Query: 67-154,174-251
View the alignment between query and template
View the model in PyMOL
Template: 1UZK, chain A
Confidence level:very confident
Coverage over the Query: 113-211,223-274
View the alignment between query and template
View the model in PyMOL
Template: 1GL4, chain A
Confidence level:very confident
Coverage over the Query: 1-63
View the alignment between query and template
View the model in PyMOL