Psyllid ID: psy5750
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| 313213721 | 738 | unnamed protein product [Oikopleura dioi | 0.559 | 0.216 | 0.375 | 2e-22 | |
| 301605595 | 2509 | PREDICTED: fibrillin-2-like [Xenopus (Si | 0.548 | 0.062 | 0.375 | 2e-21 | |
| 341901723 | 298 | hypothetical protein CAEBREN_31585 [Caen | 0.489 | 0.469 | 0.377 | 3e-21 | |
| 390335314 | 1785 | PREDICTED: uncharacterized protein LOC58 | 0.573 | 0.091 | 0.377 | 4e-21 | |
| 198430297 | 2830 | PREDICTED: similar to Fibrillin-2 [Ciona | 0.566 | 0.057 | 0.361 | 4e-21 | |
| 449278484 | 718 | Nidogen-2, partial [Columba livia] | 0.520 | 0.207 | 0.379 | 5e-21 | |
| 260823668 | 310 | hypothetical protein BRAFLDRAFT_147130 [ | 0.569 | 0.525 | 0.394 | 5e-21 | |
| 198435677 | 2125 | PREDICTED: similar to predicted protein | 0.643 | 0.086 | 0.348 | 1e-20 | |
| 321473827 | 1373 | hypothetical protein DAPPUDRAFT_314322 [ | 0.678 | 0.141 | 0.339 | 1e-20 | |
| 260794094 | 1172 | hypothetical protein BRAFLDRAFT_79634 [B | 0.636 | 0.155 | 0.342 | 2e-20 |
| >gi|313213721|emb|CBY40610.1| unnamed protein product [Oikopleura dioica] | Back alignment and taxonomy information |
|---|
Score = 112 bits (279), Expect = 2e-22, Method: Compositional matrix adjust.
Identities = 69/184 (37%), Positives = 98/184 (53%), Gaps = 24/184 (13%)
Query: 76 CVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEI 135
C AN+ CI +D +C+C+ GF + CFDINECN G ++C NA+C N +
Sbjct: 326 CSANADCIDLEDGFSCVCHAGFGGSGQK--------CFDINECNNGENVCSPNAICNNVV 377
Query: 136 GSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPG 195
GS+ C C+PGF GNG C EI C +D C+P S T ++ C C+ G
Sbjct: 378 GSFECSCKPGFMGNGVVCNEI--------DECANDLDNCSPNASCMTPRGSFQ-CTCNDG 428
Query: 196 YQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGK 255
+ D + +C D +EC C++NA C+N G ++C CK GF GDGF C++
Sbjct: 429 FNGDGV-------ICFDKNECALGKDNCDSNAHCLNTGGGFECLCKNGFKGDGFTCQDIN 481
Query: 256 YCLV 259
C+V
Sbjct: 482 ECVV 485
|
Source: Oikopleura dioica Species: Oikopleura dioica Genus: Oikopleura Family: Oikopleuridae Order: Class: Appendicularia Phylum: Chordata Superkingdom: Eukaryota |
| >gi|301605595|ref|XP_002932430.1| PREDICTED: fibrillin-2-like [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|341901723|gb|EGT57658.1| hypothetical protein CAEBREN_31585 [Caenorhabditis brenneri] | Back alignment and taxonomy information |
|---|
| >gi|390335314|ref|XP_788037.3| PREDICTED: uncharacterized protein LOC583016 [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|198430297|ref|XP_002124637.1| PREDICTED: similar to Fibrillin-2 [Ciona intestinalis] | Back alignment and taxonomy information |
|---|
| >gi|449278484|gb|EMC86306.1| Nidogen-2, partial [Columba livia] | Back alignment and taxonomy information |
|---|
| >gi|260823668|ref|XP_002606202.1| hypothetical protein BRAFLDRAFT_147130 [Branchiostoma floridae] gi|229291542|gb|EEN62212.1| hypothetical protein BRAFLDRAFT_147130 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|198435677|ref|XP_002124086.1| PREDICTED: similar to predicted protein [Ciona intestinalis] | Back alignment and taxonomy information |
|---|
| >gi|321473827|gb|EFX84793.1| hypothetical protein DAPPUDRAFT_314322 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|260794094|ref|XP_002592045.1| hypothetical protein BRAFLDRAFT_79634 [Branchiostoma floridae] gi|229277258|gb|EEN48056.1| hypothetical protein BRAFLDRAFT_79634 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| ZFIN|ZDB-GENE-050302-58 | 1269 | nid1a "nidogen 1a" [Danio reri | 0.555 | 0.125 | 0.354 | 6.6e-28 | |
| UNIPROTKB|F1MWN3 | 1236 | F1MWN3 "Uncharacterized protei | 0.611 | 0.141 | 0.323 | 1.6e-25 | |
| UNIPROTKB|F1P7Y6 | 759 | NID2 "Uncharacterized protein" | 0.597 | 0.225 | 0.353 | 1.7e-25 | |
| UNIPROTKB|F1MF97 | 1303 | NID2 "Uncharacterized protein" | 0.493 | 0.108 | 0.391 | 2.3e-25 | |
| UNIPROTKB|P14543 | 1247 | NID1 "Nidogen-1" [Homo sapiens | 0.562 | 0.129 | 0.331 | 5.6e-25 | |
| MGI|MGI:97342 | 1245 | Nid1 "nidogen 1" [Mus musculus | 0.594 | 0.136 | 0.328 | 1.5e-24 | |
| UNIPROTKB|Q14112 | 1375 | NID2 "Nidogen-2" [Homo sapiens | 0.493 | 0.102 | 0.379 | 1.9e-24 | |
| UNIPROTKB|E1BNX3 | 1148 | Bt.112199 "Uncharacterized pro | 0.664 | 0.165 | 0.322 | 3.1e-24 | |
| RGD|1311685 | 1396 | Nid2 "nidogen 2 (osteonidogen) | 0.493 | 0.101 | 0.355 | 4.1e-24 | |
| UNIPROTKB|Q14246 | 886 | EMR1 "EGF-like module-containi | 0.650 | 0.209 | 0.337 | 8.9e-24 |
| ZFIN|ZDB-GENE-050302-58 nid1a "nidogen 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 276 (102.2 bits), Expect = 6.6e-28, Sum P(2) = 6.6e-28
Identities = 68/192 (35%), Positives = 93/192 (48%)
Query: 76 CVANSSCIV-EDDKPTCICNRGFQQLYSEDRLQDDFGCF-DINECNAGTDLCHKNAMCFN 133
C N+ C + ++ TC C GF D C+ DI+EC +C +N++C N
Sbjct: 662 CDTNAVCKPGQGNQFTCECAAGFTG--------DGRACYADIDECRETPQICGQNSICNN 713
Query: 134 EIGSYSCQCRPGF--TGNGHQCTEITVPQTGPTSPCESDPRACN-PPHSTC--TNLTDYR 188
+ G++ C+C GF +G C E+ P PC S C+ P + C T + Y
Sbjct: 714 QPGTFRCECLDGFQFASDGQTCVEVH----RPVDPCRSGTHDCDVPERARCSYTGGSSY- 768
Query: 189 TCNCDPGYQKDYLDDRRVAFVCTDVDEC-MNYPPICNNNADCINRPGTYQCQCKRGFSGD 247
C C PG+ D RR C D+DEC +N C+ NA C N PG++ CQC GF GD
Sbjct: 769 ICTCAPGFMGD---GRR----CQDIDECQVNQ---CHENAVCFNTPGSFSCQCNPGFHGD 818
Query: 248 GFNCEEG--KYC 257
GF C G K C
Sbjct: 819 GFYCSTGSEKSC 830
|
|
| UNIPROTKB|F1MWN3 F1MWN3 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P7Y6 NID2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MF97 NID2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P14543 NID1 "Nidogen-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:97342 Nid1 "nidogen 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14112 NID2 "Nidogen-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BNX3 Bt.112199 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1311685 Nid2 "nidogen 2 (osteonidogen)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14246 EMR1 "EGF-like module-containing mucin-like hormone receptor-like 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 286 | |||
| pfam12947 | 36 | pfam12947, EGF_3, EGF domain | 1e-07 | |
| cd00255 | 224 | cd00255, nidG2, Nidogen, G2 domain; Nidogen is an | 3e-07 | |
| pfam07645 | 42 | pfam07645, EGF_CA, Calcium-binding EGF domain | 4e-07 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 6e-07 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 1e-06 | |
| pfam12947 | 36 | pfam12947, EGF_3, EGF domain | 2e-06 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 3e-06 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 3e-06 | |
| smart00682 | 227 | smart00682, G2F, G2 nidogen domain and fibulin | 3e-06 | |
| pfam07645 | 42 | pfam07645, EGF_CA, Calcium-binding EGF domain | 2e-05 | |
| pfam07474 | 193 | pfam07474, G2F, G2F domain | 1e-04 | |
| cd00053 | 36 | cd00053, EGF, Epidermal growth factor domain, foun | 0.001 | |
| cd00053 | 36 | cd00053, EGF, Epidermal growth factor domain, foun | 0.003 |
| >gnl|CDD|205157 pfam12947, EGF_3, EGF domain | Back alignment and domain information |
|---|
Score = 46.8 bits (112), Expect = 1e-07
Identities = 16/36 (44%), Positives = 21/36 (58%)
Query: 118 CNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQC 153
C CH NA C N GS++C C+ G+TG+G C
Sbjct: 1 CAENNGGCHPNATCTNTGGSFTCTCKSGYTGDGVTC 36
|
This family includes a variety of EGF-like domain homologues. This family includes the C-terminal domain of the malaria parasite MSP1 protein. Length = 36 |
| >gnl|CDD|238158 cd00255, nidG2, Nidogen, G2 domain; Nidogen is an important component of the basement membrane, an extracellular sheet-like matrix | Back alignment and domain information |
|---|
| >gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|205157 pfam12947, EGF_3, EGF domain | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214774 smart00682, G2F, G2 nidogen domain and fibulin | Back alignment and domain information |
|---|
| >gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain | Back alignment and domain information |
|---|
| >gnl|CDD|219422 pfam07474, G2F, G2F domain | Back alignment and domain information |
|---|
| >gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| KOG1214|consensus | 1289 | 99.96 | ||
| KOG1214|consensus | 1289 | 99.71 | ||
| KOG1219|consensus | 4289 | 99.52 | ||
| KOG4289|consensus | 2531 | 99.5 | ||
| KOG1219|consensus | 4289 | 99.48 | ||
| smart00682 | 227 | G2F G2 nidogen domain and fibulin. | 99.34 | |
| PF07474 | 192 | G2F: G2F domain; InterPro: IPR006605 Basement memb | 99.29 | |
| cd00255 | 224 | nidG2 Nidogen, G2 domain; Nidogen is an important | 99.27 | |
| KOG1217|consensus | 487 | 99.13 | ||
| KOG1217|consensus | 487 | 99.08 | ||
| KOG4289|consensus | 2531 | 98.99 | ||
| KOG4260|consensus | 350 | 98.9 | ||
| KOG4260|consensus | 350 | 98.9 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 98.89 | |
| KOG1225|consensus | 525 | 98.83 | ||
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 98.81 | |
| KOG1225|consensus | 525 | 98.71 | ||
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 98.39 | |
| KOG1226|consensus | 783 | 98.37 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 98.36 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 98.32 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 98.07 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 98.01 | |
| KOG1226|consensus | 783 | 97.81 | ||
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.8 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.79 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.75 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 97.65 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 97.57 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 97.56 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 97.55 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 97.48 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.42 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.86 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 96.81 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 96.79 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 96.57 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 96.25 | |
| KOG0994|consensus | 1758 | 96.06 | ||
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 95.86 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 95.83 | |
| PF12946 | 37 | EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 | 95.71 | |
| PF12946 | 37 | EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 | 94.8 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 94.44 | |
| KOG0994|consensus | 1758 | 93.55 | ||
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 93.53 | |
| KOG1836|consensus | 1705 | 92.25 | ||
| PF01683 | 52 | EB: EB module; InterPro: IPR006149 The EB domain h | 88.57 | |
| smart00051 | 63 | DSL delta serrate ligand. | 87.92 | |
| KOG1836|consensus | 1705 | 86.88 | ||
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 86.58 | |
| PF12955 | 103 | DUF3844: Domain of unknown function (DUF3844); Int | 85.15 |
| >KOG1214|consensus | Back alignment and domain information |
|---|
Probab=99.96 E-value=2.1e-29 Score=231.23 Aligned_cols=244 Identities=31% Similarity=0.698 Sum_probs=200.9
Q ss_pred CccceEEEEEEC-CCCeEEEeEeeeccCccCCeeeeEEEeeccCCcccCCcceeecceeeeeec----------------
Q psy5750 1 GVFNYSAELIFS-TGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHS---------------- 63 (286)
Q Consensus 1 g~~~~~~~~~~~-~~~~~~~~~~~~g~~~~~~~~~~~~~~g~~p~~~~~~~~~~~~~~~~~~~~---------------- 63 (286)
+.|+|.+++.|. +...++|+|++.|+|.+.+|++++.++|.+|.++.+...++.+|++.|++.
T Consensus 541 ~~ftr~~evtf~g~~~~~vi~q~~~g~d~~~~l~ikt~~~G~vp~~p~~~~~hi~py~elyHys~s~vtstssr~y~~t~ 620 (1289)
T KOG1214|consen 541 AAFTRDMEVTFYGGEETVVITQTAEGLDPENYLSIKTNIQGQVPYVPANFTAHISPYKELYHYSDSTVTSTSSRDYSLTF 620 (1289)
T ss_pred cccccCceEEecCCcceeeeeeecCCCCCCceEEEecccccccceeccccccccCcchhhhhcccceeecccccceeeec
Confidence 468999999999 678899999999999999999999999999999999999999999988773
Q ss_pred -------------------------------------------------------------------CcCCCCCCC--CC
Q psy5750 64 -------------------------------------------------------------------STVNDDPCK--NF 74 (286)
Q Consensus 64 -------------------------------------------------------------------~~~~~~~C~--~~ 74 (286)
.....++|- ++
T Consensus 621 ga~~S~~~sy~~hq~ityq~C~h~~~~p~~p~tqql~vd~vfalyn~ee~~lr~a~Sn~igpV~E~S~~~~~npCy~gsh 700 (1289)
T KOG1214|consen 621 GAINSQTWSYRIHQNITYQVCRHAPRHPSFPTTQQLNVDRVFALYNDEERVLRFAVSNQIGPVKEDSDPTPVNPCYDGSH 700 (1289)
T ss_pred CcccccceeEEEeecceeEEeecCCCCCCCCCceEeecccceeccCccccchhhhhhhcccceecCCCCcccccceecCc
Confidence 011223332 25
Q ss_pred CCCCCCeeeeCC-CCCeEecCCCcccccccccCCCCCCCccCCCcCCCCCCCCCCCeeecCCCCeeEeCCCCcc--cCCC
Q psy5750 75 FCVANSSCIVED-DKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFT--GNGH 151 (286)
Q Consensus 75 ~C~~~~~C~~~~-g~~~C~C~~g~~~~~c~~~~~~~~~C~~~~~C~~~~~~C~~~~~C~~~~g~~~C~C~~G~~--g~~~ 151 (286)
.|..++.|.... -.|+|.|..||.+ +++.|.++++|+.+.+.|..+++|++.+++|+|.|..||. +++.
T Consensus 701 ~cdt~a~C~pg~~~~~tcecs~g~~g--------dgr~c~d~~eca~~~~~CGp~s~Cin~pg~~rceC~~gy~F~dd~~ 772 (1289)
T KOG1214|consen 701 MCDTTARCHPGTGVDYTCECSSGYQG--------DGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRH 772 (1289)
T ss_pred ccCCCccccCCCCcceEEEEeeccCC--------CCCCCCChhhhccCCCCCCCCceeecCCCceeEEEeecceeccCCc
Confidence 577778888773 4789999999985 4889999999999889999999999999999999999876 6778
Q ss_pred ceecccCCCCCCCCCCCCCCCCCCCCCCcc--cc-CCCCceeeCCCCCCCCCCCCcccCCccccCCCcCCCCCCCCCCCe
Q psy5750 152 QCTEITVPQTGPTSPCESDPRACNPPHSTC--TN-LTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNAD 228 (286)
Q Consensus 152 ~C~~~~~~~~~~~~~C~~~~~~C~~~~~~C--~~-~~g~~~C~C~~G~~g~~~~~~~~~~~C~d~deC~~~~~~C~~~~~ 228 (286)
+|..+..+ ..++.|..+.+.| ...+.| +. ..+.|.|.|.+||.|++. .|.|+|||..+ .|++++.
T Consensus 773 tCV~i~~p--ap~n~Ce~g~h~C-~i~g~a~c~~hGgs~y~C~CLPGfsGDG~-------~c~dvDeC~ps--rChp~A~ 840 (1289)
T KOG1214|consen 773 TCVLITPP--APANPCEDGSHTC-AIAGQARCVHHGGSTYSCACLPGFSGDGH-------QCTDVDECSPS--RCHPAAT 840 (1289)
T ss_pred ceEEecCC--CCCCccccCcccc-CcCCceEEEecCCceEEEeecCCccCCcc-------ccccccccCcc--ccCCCce
Confidence 89765432 3467888877888 666554 44 446899999999999966 89999999965 5999999
Q ss_pred eeeCCCCeeeecCCCCcCCCCCcCCCCeeecccccccccc
Q psy5750 229 CINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMY 268 (286)
Q Consensus 229 C~n~~g~y~C~C~~Gy~gdg~~C~~~~~c~~~~~~~c~~~ 268 (286)
|+|++|+|.|+|.+||+|||+.|--. . ..++.|+..
T Consensus 841 CyntpgsfsC~C~pGy~GDGf~CVP~-~---~~~T~C~~e 876 (1289)
T KOG1214|consen 841 CYNTPGSFSCRCQPGYYGDGFQCVPD-T---SSLTPCEQE 876 (1289)
T ss_pred EecCCCcceeecccCccCCCceecCC-C---ccCCccccc
Confidence 99999999999999999999999322 1 124556654
|
|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >smart00682 G2F G2 nidogen domain and fibulin | Back alignment and domain information |
|---|
| >PF07474 G2F: G2F domain; InterPro: IPR006605 Basement membranes are sheet-like extracellular matrices found at the basal surfaces of epithelia and condensed mesenchyma | Back alignment and domain information |
|---|
| >cd00255 nidG2 Nidogen, G2 domain; Nidogen is an important component of the basement membrane, an extracellular sheet-like matrix | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein | Back alignment and domain information |
|---|
| >PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 286 | ||||
| 2vj3_A | 135 | Human Notch-1 Egfs 11-13 Length = 135 | 1e-09 | ||
| 1toz_A | 116 | Nmr Structure Of The Human Notch-1 Ligand Binding R | 3e-09 | ||
| 2bo2_A | 143 | Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune Syst | 7e-07 | ||
| 2w86_A | 147 | Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 | 2e-05 |
| >pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 | Back alignment and structure |
|
| >pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 | Back alignment and structure |
| >pdb|2BO2|A Chain A, Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune System Molecule, In Complex With Calcium. Length = 143 | Back alignment and structure |
| >pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 286 | |||
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 5e-22 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 3e-16 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 7e-10 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 2e-08 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 2e-04 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 1e-21 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 7e-14 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 3e-18 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 2e-10 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 4e-17 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 2e-09 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 6e-17 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 1e-10 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 4e-08 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 1e-14 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 6e-09 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 2e-14 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 6e-07 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 7e-04 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 9e-13 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 4e-10 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 2e-06 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 1e-12 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 3e-06 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 2e-12 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 2e-06 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 4e-04 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 7e-12 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 1e-11 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 2e-08 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 4e-06 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 2e-11 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 5e-10 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 8e-09 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 1e-08 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 9e-10 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 3e-09 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 1e-08 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 4e-06 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 2e-05 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 4e-08 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 2e-07 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 4e-04 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 2e-07 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 9e-05 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 5e-07 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 1e-05 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 2e-06 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 3e-05 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 4e-06 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 2e-05 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 1e-04 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 3e-05 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 2e-04 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 3e-05 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 4e-05 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 7e-05 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 1e-04 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 1e-04 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 4e-04 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 6e-04 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 6e-04 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 7e-04 |
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
Score = 89.0 bits (221), Expect = 5e-22
Identities = 32/165 (19%), Positives = 51/165 (30%), Gaps = 29/165 (17%)
Query: 90 TCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGN 149
C C F+ GC D N C+ + + G +C G +
Sbjct: 25 ICDCPPDFE------LNPTRVGCVDTRSGN-----CYLDIRPRGDNGDTACSNEIGVGVS 73
Query: 150 GHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFV 209
C P P C G++ + + +
Sbjct: 74 KASCCCSLG-------KAWGTPCEMCP---AVNTSEYKILCPGGEGFRPNP-----ITVI 118
Query: 210 CTDVDECMNYPPICNNNADCINRPGTYQCQCKRGF--SGDGFNCE 252
D+DEC P +C CIN G++QC+C G+ + D C+
Sbjct: 119 LEDIDECQELPGLC-QGGKCINTFGSFQCRCPTGYYLNEDTRVCD 162
|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Length = 99 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Length = 105 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.89 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.88 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.87 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 99.83 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.83 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.82 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.78 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.78 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.75 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.75 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.72 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 99.67 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 99.65 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.61 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.57 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.56 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 99.55 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 99.55 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.54 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 99.54 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 99.51 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.42 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.41 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.4 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 99.4 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.38 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 99.33 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.33 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.31 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 99.31 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.29 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 99.28 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 99.28 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.28 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 99.27 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 99.26 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 99.24 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 99.23 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 99.21 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 99.21 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 99.19 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.19 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 99.18 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 99.17 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.12 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 99.1 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 99.09 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.06 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.05 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 98.97 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.94 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.9 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.85 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.73 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.69 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.69 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.68 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.67 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.64 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 98.61 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.59 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.56 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.49 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 98.45 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.44 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 98.43 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 98.39 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.35 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.32 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 98.31 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 98.29 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 98.21 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.19 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 98.13 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 98.13 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.12 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.05 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.0 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 97.98 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 97.9 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 97.89 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 97.89 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.83 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 97.82 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 97.8 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.79 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 97.79 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 97.78 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.75 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 97.67 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 97.64 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 97.62 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 97.6 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 97.6 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.44 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 97.43 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 97.41 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 97.38 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.27 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 97.25 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 97.15 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 97.12 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 97.1 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 97.03 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 96.83 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 96.8 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 96.69 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 96.64 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 96.38 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 96.32 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 96.31 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 96.26 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 96.2 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 96.2 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 96.13 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 96.1 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 96.02 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 95.74 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 95.51 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 95.44 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 94.99 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 94.98 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 94.92 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 94.57 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 94.44 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 94.44 | |
| 1b9w_A | 95 | Protein (merozoite surface protein 1); MSP-1, cand | 94.13 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 94.12 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 93.99 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 93.4 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 93.28 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 93.18 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 93.14 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 92.97 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 92.91 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 92.64 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 92.37 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 92.36 | |
| 3fby_A | 551 | COMP, cartilage oligomeric matrix protein; signatu | 92.24 | |
| 1b9w_A | 95 | Protein (merozoite surface protein 1); MSP-1, cand | 92.14 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 91.56 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 91.48 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 91.15 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 90.37 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 90.35 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 89.59 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 89.54 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 88.41 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 87.41 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 87.39 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 85.63 | |
| 3fby_A | 551 | COMP, cartilage oligomeric matrix protein; signatu | 83.36 |
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
Probab=99.89 E-value=1.8e-24 Score=175.49 Aligned_cols=149 Identities=27% Similarity=0.646 Sum_probs=125.0
Q ss_pred CCCCCCCCCeeeeCCCCCeEecCCCcccccccccCCCCCCCccCCCcCCC--CCCCCCCCeeecCC-----CCeeEeCCC
Q psy5750 72 KNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAG--TDLCHKNAMCFNEI-----GSYSCQCRP 144 (286)
Q Consensus 72 ~~~~C~~~~~C~~~~g~~~C~C~~g~~~~~c~~~~~~~~~C~~~~~C~~~--~~~C~~~~~C~~~~-----g~~~C~C~~ 144 (286)
..+||. +++|++..++|+|.|++||++. ++..|.++++|... .++|.+++.|++.. ++|+|.|++
T Consensus 9 ~~~pC~-ng~C~~~~g~~~C~C~~G~~g~-------~~~~C~~id~C~~~~~~~~C~~~~~C~~~~~~~~~g~y~C~C~~ 80 (186)
T 1z1y_A 9 VDTICX-NGQLVQMSNHFXCMCNEGLVHL-------SENTCEEXNECXXETLGXACGEFGQCIENPDPAQVNMYXCGCIE 80 (186)
T ss_dssp TTCCCB-TEEEEECSSCEEEEECTTEEEE-------ETTEEEECCCCSGGGTTSEEETTEEEEECSSTTSSCSEEEEECT
T ss_pred CCCCCC-CCEeECCCCCeEeECCCCCccC-------CCCccCCCCcccCCCCCCCCCCCCEeecCCCCcCCCCEECCCCC
Confidence 447888 4699999999999999999976 25678899999843 37899999999998 899999999
Q ss_pred CcccCCCceecccCCCCCCCCCCCCCCCCCCCCCCccc----cCCCCceeeCCCCCCCCCCCCcccCCccccC--CCcCC
Q psy5750 145 GFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCT----NLTDYRTCNCDPGYQKDYLDDRRVAFVCTDV--DECMN 218 (286)
Q Consensus 145 G~~g~~~~C~~~~~~~~~~~~~C~~~~~~C~~~~~~C~----~~~g~~~C~C~~G~~g~~~~~~~~~~~C~d~--deC~~ 218 (286)
||+|+...|. +++|.. .+| .+++.|+ +..++|+|.|++||+|.. .++..|+++ ++|..
T Consensus 81 G~~g~~~~C~---------~d~C~~--~~C-~~~g~C~~~~~~~~g~~~C~C~~Gy~g~~----~~~~~C~~~~~~~C~~ 144 (186)
T 1z1y_A 81 GYTLXEDTCV---------LDVCQY--XNC-GESGECIVEYLSEIQSAGCSCAIGXVPNP----EDEXXCTXTGETACQL 144 (186)
T ss_dssp TEEEETTEEE---------EGGGTT--CCC-CTTEEEEEEEETTEEEEEEEECTEEEEET----TTTTEEEEEECCCCCC
T ss_pred CCccCCCCCC---------CCcCcC--CCC-CCCCEEeeCCcCCCCCceEECCCCCcccC----CCCCcceEcCCCcccc
Confidence 9998655665 478887 579 8889998 888899999999999832 012278765 89974
Q ss_pred CCCCC-CCCCeeeeCCCCeeeecCCCCcCC
Q psy5750 219 YPPIC-NNNADCINRPGTYQCQCKRGFSGD 247 (286)
Q Consensus 219 ~~~~C-~~~~~C~n~~g~y~C~C~~Gy~gd 247 (286)
.| .++++|+|++++|+|.|++||+|+
T Consensus 145 ---~C~~~~~~C~n~~g~y~C~C~~G~~g~ 171 (186)
T 1z1y_A 145 ---XCNTDNEVCXNVEGVYXCQCMEGFTFD 171 (186)
T ss_dssp ---CCCTTTEEEEEETTEEEEEECTTCEEE
T ss_pred ---cccccCcceecCCCCeeeECCCCCccC
Confidence 59 889999999999999999999998
|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 286 | ||||
| d1gl4a2 | 40 | g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 | 2e-09 | |
| d1gl4a2 | 40 | g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 | 3e-06 | |
| d1gl4a1 | 233 | d.22.1.2 (A:399-631) Domain G2 of nidogen-1 {Mouse | 3e-08 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 1e-07 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 2e-07 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 2e-07 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 6e-07 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 2e-06 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 3e-06 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 1e-05 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 2e-05 | |
| d1lmja2 | 42 | g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien | 2e-05 | |
| d1lmja2 | 42 | g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien | 5e-05 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 2e-05 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 1e-04 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 3e-05 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 7e-05 | |
| d1apqa_ | 53 | g.3.11.1 (A:) Complement protease C1R {Human (Homo | 4e-05 | |
| d1apqa_ | 53 | g.3.11.1 (A:) Complement protease C1R {Human (Homo | 1e-04 | |
| d1dx5i3 | 40 | g.3.11.1 (I:423-462) Thrombomodulin, different EGF | 4e-05 | |
| d1dx5i3 | 40 | g.3.11.1 (I:423-462) Thrombomodulin, different EGF | 0.001 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 1e-04 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 6e-04 | |
| d1uzka1 | 43 | g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa | 2e-04 | |
| d1uzka1 | 43 | g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa | 3e-04 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 4e-04 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 0.004 | |
| d2vj3a3 | 35 | g.3.11.1 (A:492-526) Neurogenic locus notch homolo | 9e-04 | |
| d1nt0a3 | 45 | g.3.11.1 (A:120-164) Mannose-binding protein assoc | 0.001 | |
| d1szba2 | 45 | g.3.11.1 (A:124-168) Mannose-binding protein assoc | 0.001 | |
| d1g1ta2 | 39 | g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human | 0.002 | |
| d1g1sa2 | 40 | g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human | 0.003 | |
| d1i0ua2 | 41 | g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r | 0.004 |
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-like domain of nidogen-1 domain: EGF-like domain of nidogen-1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 50.2 bits (120), Expect = 2e-09
Identities = 12/37 (32%), Positives = 17/37 (45%)
Query: 118 CNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCT 154
C C +A C + + C+C +TGNG QC
Sbjct: 2 CANNRHQCSVHAECRDYATGFCCRCVANYTGNGRQCV 38
|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
| >d1gl4a1 d.22.1.2 (A:399-631) Domain G2 of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 233 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| d1gl4a1 | 233 | Domain G2 of nidogen-1 {Mouse (Mus musculus) [TaxI | 99.19 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.12 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 99.1 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 99.05 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.95 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 98.92 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.92 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.91 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.9 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 98.88 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.84 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.78 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.78 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.78 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.75 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.74 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.72 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.71 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.64 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.63 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.62 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 98.56 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 98.52 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 98.52 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 98.51 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.47 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.46 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.41 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 98.39 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.39 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 98.36 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.34 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.33 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.29 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 98.25 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.24 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.24 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 98.22 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.21 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 98.19 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 98.17 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.13 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.13 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.11 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.08 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 98.03 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 97.92 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.79 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 97.74 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.72 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 97.7 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 97.65 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.55 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.47 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 97.45 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.38 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 97.37 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 97.34 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 97.28 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 97.27 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.22 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.05 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 97.04 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 96.97 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 96.53 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 96.2 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 96.14 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 96.06 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 95.96 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 95.45 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 95.3 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 95.16 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 95.11 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 94.88 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 94.55 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 94.35 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 94.27 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 93.17 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 91.44 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 89.78 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 89.08 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 88.8 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 88.28 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 81.26 |
| >d1gl4a1 d.22.1.2 (A:399-631) Domain G2 of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: GFP-like superfamily: GFP-like family: Domain G2 of nidogen-1 domain: Domain G2 of nidogen-1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.19 E-value=1.3e-11 Score=98.82 Aligned_cols=63 Identities=27% Similarity=0.446 Sum_probs=60.4
Q ss_pred CccceEEEEEEC-CCCeEEEeEeeeccCccCCeeeeEEEeeccCCcccCCcceeecceeeeeec
Q psy5750 1 GVFNYSAELIFS-TGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHS 63 (286)
Q Consensus 1 g~~~~~~~~~~~-~~~~~~~~~~~~g~~~~~~~~~~~~~~g~~p~~~~~~~~~~~~~~~~~~~~ 63 (286)
|.|+|+++|+|. +++.|+|+|+|.|+|.++.|.+++.+.|.+|.+++++.+++.||.|.|+..
T Consensus 86 G~F~~~s~v~F~~~~~~l~i~q~~~GlD~~~~L~v~~~i~G~VP~i~~~a~v~i~dY~E~Y~~~ 149 (233)
T d1gl4a1 86 GEFTRQAEVTFLGHPGKLVLKQQFSGIDEHGHLTISTELEGRVPQIPYGASVHIEPYTELYHYS 149 (233)
T ss_dssp TEEEEEEEEEETTSSSCEEEEEEEECBCTTSCEECEEEEEEEECCCCTTCEEECCCEEEEEEEE
T ss_pred eEEEEEEEEEEcCCCcEEEEEEEEEccCcCCeEEEEEEEEeEcCCCCCCCEEEeCCceEEEEeC
Confidence 789999999997 889999999999999999999999999999999999999999999999653
|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|