Psyllid ID: psy5750


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
GVFNYSAELIFSTGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHSSTVNDDPCKNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMYLEVVNIQEICGENSISGL
ccccccEEEEEccccEEEEcccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEcccccccccccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccEEEccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccccccEEEcccccccccccccc
cccccccccccccccEccccccccccccccEEcccccEEEEccccccccccEccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccEccccHHccccccccccccEEEcccccEEEEccccccccccEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccEEcccHHccccccccccccEEEcccccEEEEccccccccccEEcccHHHccccccccccccEEcccccEEEEcccccc
GVFNYSAELIFstgqrlhvqeeffghdvydqlkmqgsiqgtapsiavgvspvledlqqefthsstvnddpcknffcvanssciveddkptcicnrgfqqlysedrlqddfgcfdinecnagtdlchknamcfneigsyscqcrpgftgnghqcteitvpqtgptspcesdpracnpphstctnltdyrtcncdpgyqkdylddrrvafvctdvdecmnyppicnnnadcinrpgtyqcqckrgfsgdgfnceegKYCLVVGITLCKMYLEVVNIQEIcgensisgl
GVFNYSAELIFSTGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHsstvnddpckNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMYLEVVNIQEICGENSISGL
GVFNYSAELIFSTGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHSSTVNDDPCKNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMYLEVVNIQEICGENSISGL
**FNYSAELIFSTGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHSSTVNDDPCKNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCTEITV*********************TCTNLTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMYLEVVNIQEICG*******
GVFNYSAELIFSTGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHSSTVNDDPCKNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMYLEVVNIQEICGENSISGL
GVFNYSAELIFSTGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHSSTVNDDPCKNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCTEITVP**************CNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMYLEVVNIQEICGENSISGL
*VFNYSAELIFSTGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHSSTVNDDPCKNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMYLEVVNIQEICGENSISGL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GVFNYSAELIFSTGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHSSTVNDDPCKNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMYLEVVNIQEICGENSISGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
Q14246 886 EGF-like module-containin yes N/A 0.545 0.176 0.354 8e-18
A1A5Y0 811 Protein kinase C-binding no N/A 0.580 0.204 0.289 7e-17
P35555 2871 Fibrillin-1 OS=Homo sapie no N/A 0.479 0.047 0.371 1e-16
P98133 2871 Fibrillin-1 OS=Bos taurus no N/A 0.479 0.047 0.365 2e-16
Q14112 1375 Nidogen-2 OS=Homo sapiens no N/A 0.493 0.102 0.373 2e-16
Q61554 2871 Fibrillin-1 OS=Mus muscul yes N/A 0.479 0.047 0.365 3e-16
Q7ZXL5 814 Protein kinase C-binding N/A N/A 0.597 0.210 0.305 6e-16
Q9TV36 2871 Fibrillin-1 OS=Sus scrofa no N/A 0.489 0.048 0.357 2e-15
B5DFC9 1396 Nidogen-2 OS=Rattus norve yes N/A 0.493 0.101 0.349 3e-15
Q61549 931 EGF-like module-containin no N/A 0.566 0.174 0.331 3e-15
>sp|Q14246|EMR1_HUMAN EGF-like module-containing mucin-like hormone receptor-like 1 OS=Homo sapiens GN=EMR1 PE=2 SV=3 Back     alignment and function desciption
 Score = 91.3 bits (225), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 87/175 (49%), Gaps = 19/175 (10%)

Query: 76  CVANSSCIVEDDKPTCICNRGFQQLYSEDRLQD---DFGCFDINECNAGTDLCHKNAMCF 132
           C  NSSC     +  C C  GF      D +     +F C DINEC   + +C +++ C 
Sbjct: 91  CGPNSSCKNLSGRYKCSCLDGFSSPTGNDWVPGKPGNFSCTDINEC-LTSSVCPEHSDCV 149

Query: 133 NEIGSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNC 192
           N +GSYSC C+ GF      C ++          C +DPRAC P H+TC N     +C C
Sbjct: 150 NSMGSYSCSCQVGFISRNSTCEDV--------DEC-ADPRAC-PEHATCNNTVGNYSCFC 199

Query: 193 DPGYQKD--YLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFS 245
           +PG++    +L  + +   C D+DEC    PI   N+ C N PG+Y C C  GF+
Sbjct: 200 NPGFESSSGHLSFQGLKASCEDIDECTEMCPI---NSTCTNTPGSYFCTCHPGFA 251




Could be involved in cell-cell interactions.
Homo sapiens (taxid: 9606)
>sp|A1A5Y0|NELL2_DANRE Protein kinase C-binding protein NELL2 OS=Danio rerio GN=nell2 PE=2 SV=1 Back     alignment and function description
>sp|P35555|FBN1_HUMAN Fibrillin-1 OS=Homo sapiens GN=FBN1 PE=1 SV=3 Back     alignment and function description
>sp|P98133|FBN1_BOVIN Fibrillin-1 OS=Bos taurus GN=FBN1 PE=1 SV=1 Back     alignment and function description
>sp|Q14112|NID2_HUMAN Nidogen-2 OS=Homo sapiens GN=NID2 PE=1 SV=3 Back     alignment and function description
>sp|Q61554|FBN1_MOUSE Fibrillin-1 OS=Mus musculus GN=Fbn1 PE=1 SV=1 Back     alignment and function description
>sp|Q7ZXL5|NELL2_XENLA Protein kinase C-binding protein NELL2 OS=Xenopus laevis GN=nell2 PE=2 SV=1 Back     alignment and function description
>sp|Q9TV36|FBN1_PIG Fibrillin-1 OS=Sus scrofa GN=FBN1 PE=2 SV=1 Back     alignment and function description
>sp|B5DFC9|NID2_RAT Nidogen-2 OS=Rattus norvegicus GN=Nid2 PE=2 SV=1 Back     alignment and function description
>sp|Q61549|EMR1_MOUSE EGF-like module-containing mucin-like hormone receptor-like 1 OS=Mus musculus GN=Emr1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
313213721 738 unnamed protein product [Oikopleura dioi 0.559 0.216 0.375 2e-22
301605595 2509 PREDICTED: fibrillin-2-like [Xenopus (Si 0.548 0.062 0.375 2e-21
341901723298 hypothetical protein CAEBREN_31585 [Caen 0.489 0.469 0.377 3e-21
390335314 1785 PREDICTED: uncharacterized protein LOC58 0.573 0.091 0.377 4e-21
198430297 2830 PREDICTED: similar to Fibrillin-2 [Ciona 0.566 0.057 0.361 4e-21
449278484 718 Nidogen-2, partial [Columba livia] 0.520 0.207 0.379 5e-21
260823668310 hypothetical protein BRAFLDRAFT_147130 [ 0.569 0.525 0.394 5e-21
198435677 2125 PREDICTED: similar to predicted protein 0.643 0.086 0.348 1e-20
321473827 1373 hypothetical protein DAPPUDRAFT_314322 [ 0.678 0.141 0.339 1e-20
260794094 1172 hypothetical protein BRAFLDRAFT_79634 [B 0.636 0.155 0.342 2e-20
>gi|313213721|emb|CBY40610.1| unnamed protein product [Oikopleura dioica] Back     alignment and taxonomy information
 Score =  112 bits (279), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 98/184 (53%), Gaps = 24/184 (13%)

Query: 76  CVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEI 135
           C AN+ CI  +D  +C+C+ GF     +        CFDINECN G ++C  NA+C N +
Sbjct: 326 CSANADCIDLEDGFSCVCHAGFGGSGQK--------CFDINECNNGENVCSPNAICNNVV 377

Query: 136 GSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPG 195
           GS+ C C+PGF GNG  C EI          C +D   C+P  S  T    ++ C C+ G
Sbjct: 378 GSFECSCKPGFMGNGVVCNEI--------DECANDLDNCSPNASCMTPRGSFQ-CTCNDG 428

Query: 196 YQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRPGTYQCQCKRGFSGDGFNCEEGK 255
           +  D +       +C D +EC      C++NA C+N  G ++C CK GF GDGF C++  
Sbjct: 429 FNGDGV-------ICFDKNECALGKDNCDSNAHCLNTGGGFECLCKNGFKGDGFTCQDIN 481

Query: 256 YCLV 259
            C+V
Sbjct: 482 ECVV 485




Source: Oikopleura dioica

Species: Oikopleura dioica

Genus: Oikopleura

Family: Oikopleuridae

Order:

Class: Appendicularia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|301605595|ref|XP_002932430.1| PREDICTED: fibrillin-2-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|341901723|gb|EGT57658.1| hypothetical protein CAEBREN_31585 [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|390335314|ref|XP_788037.3| PREDICTED: uncharacterized protein LOC583016 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|198430297|ref|XP_002124637.1| PREDICTED: similar to Fibrillin-2 [Ciona intestinalis] Back     alignment and taxonomy information
>gi|449278484|gb|EMC86306.1| Nidogen-2, partial [Columba livia] Back     alignment and taxonomy information
>gi|260823668|ref|XP_002606202.1| hypothetical protein BRAFLDRAFT_147130 [Branchiostoma floridae] gi|229291542|gb|EEN62212.1| hypothetical protein BRAFLDRAFT_147130 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|198435677|ref|XP_002124086.1| PREDICTED: similar to predicted protein [Ciona intestinalis] Back     alignment and taxonomy information
>gi|321473827|gb|EFX84793.1| hypothetical protein DAPPUDRAFT_314322 [Daphnia pulex] Back     alignment and taxonomy information
>gi|260794094|ref|XP_002592045.1| hypothetical protein BRAFLDRAFT_79634 [Branchiostoma floridae] gi|229277258|gb|EEN48056.1| hypothetical protein BRAFLDRAFT_79634 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
ZFIN|ZDB-GENE-050302-58 1269 nid1a "nidogen 1a" [Danio reri 0.555 0.125 0.354 6.6e-28
UNIPROTKB|F1MWN3 1236 F1MWN3 "Uncharacterized protei 0.611 0.141 0.323 1.6e-25
UNIPROTKB|F1P7Y6 759 NID2 "Uncharacterized protein" 0.597 0.225 0.353 1.7e-25
UNIPROTKB|F1MF97 1303 NID2 "Uncharacterized protein" 0.493 0.108 0.391 2.3e-25
UNIPROTKB|P14543 1247 NID1 "Nidogen-1" [Homo sapiens 0.562 0.129 0.331 5.6e-25
MGI|MGI:97342 1245 Nid1 "nidogen 1" [Mus musculus 0.594 0.136 0.328 1.5e-24
UNIPROTKB|Q14112 1375 NID2 "Nidogen-2" [Homo sapiens 0.493 0.102 0.379 1.9e-24
UNIPROTKB|E1BNX3 1148 Bt.112199 "Uncharacterized pro 0.664 0.165 0.322 3.1e-24
RGD|1311685 1396 Nid2 "nidogen 2 (osteonidogen) 0.493 0.101 0.355 4.1e-24
UNIPROTKB|Q14246 886 EMR1 "EGF-like module-containi 0.650 0.209 0.337 8.9e-24
ZFIN|ZDB-GENE-050302-58 nid1a "nidogen 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 276 (102.2 bits), Expect = 6.6e-28, Sum P(2) = 6.6e-28
 Identities = 68/192 (35%), Positives = 93/192 (48%)

Query:    76 CVANSSCIV-EDDKPTCICNRGFQQLYSEDRLQDDFGCF-DINECNAGTDLCHKNAMCFN 133
             C  N+ C   + ++ TC C  GF          D   C+ DI+EC     +C +N++C N
Sbjct:   662 CDTNAVCKPGQGNQFTCECAAGFTG--------DGRACYADIDECRETPQICGQNSICNN 713

Query:   134 EIGSYSCQCRPGF--TGNGHQCTEITVPQTGPTSPCESDPRACN-PPHSTC--TNLTDYR 188
             + G++ C+C  GF    +G  C E+      P  PC S    C+ P  + C  T  + Y 
Sbjct:   714 QPGTFRCECLDGFQFASDGQTCVEVH----RPVDPCRSGTHDCDVPERARCSYTGGSSY- 768

Query:   189 TCNCDPGYQKDYLDDRRVAFVCTDVDEC-MNYPPICNNNADCINRPGTYQCQCKRGFSGD 247
              C C PG+  D    RR    C D+DEC +N    C+ NA C N PG++ CQC  GF GD
Sbjct:   769 ICTCAPGFMGD---GRR----CQDIDECQVNQ---CHENAVCFNTPGSFSCQCNPGFHGD 818

Query:   248 GFNCEEG--KYC 257
             GF C  G  K C
Sbjct:   819 GFYCSTGSEKSC 830


GO:0007160 "cell-matrix adhesion" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
UNIPROTKB|F1MWN3 F1MWN3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P7Y6 NID2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MF97 NID2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P14543 NID1 "Nidogen-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:97342 Nid1 "nidogen 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q14112 NID2 "Nidogen-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNX3 Bt.112199 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1311685 Nid2 "nidogen 2 (osteonidogen)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q14246 EMR1 "EGF-like module-containing mucin-like hormone receptor-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
pfam1294736 pfam12947, EGF_3, EGF domain 1e-07
cd00255224 cd00255, nidG2, Nidogen, G2 domain; Nidogen is an 3e-07
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 4e-07
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 6e-07
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 1e-06
pfam1294736 pfam12947, EGF_3, EGF domain 2e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 3e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 3e-06
smart00682227 smart00682, G2F, G2 nidogen domain and fibulin 3e-06
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 2e-05
pfam07474193 pfam07474, G2F, G2F domain 1e-04
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 0.001
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 0.003
>gnl|CDD|205157 pfam12947, EGF_3, EGF domain Back     alignment and domain information
 Score = 46.8 bits (112), Expect = 1e-07
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 118 CNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQC 153
           C      CH NA C N  GS++C C+ G+TG+G  C
Sbjct: 1   CAENNGGCHPNATCTNTGGSFTCTCKSGYTGDGVTC 36


This family includes a variety of EGF-like domain homologues. This family includes the C-terminal domain of the malaria parasite MSP1 protein. Length = 36

>gnl|CDD|238158 cd00255, nidG2, Nidogen, G2 domain; Nidogen is an important component of the basement membrane, an extracellular sheet-like matrix Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|205157 pfam12947, EGF_3, EGF domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214774 smart00682, G2F, G2 nidogen domain and fibulin Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|219422 pfam07474, G2F, G2F domain Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
KOG1214|consensus 1289 99.96
KOG1214|consensus 1289 99.71
KOG1219|consensus 4289 99.52
KOG4289|consensus 2531 99.5
KOG1219|consensus 4289 99.48
smart00682227 G2F G2 nidogen domain and fibulin. 99.34
PF07474192 G2F: G2F domain; InterPro: IPR006605 Basement memb 99.29
cd00255224 nidG2 Nidogen, G2 domain; Nidogen is an important 99.27
KOG1217|consensus 487 99.13
KOG1217|consensus 487 99.08
KOG4289|consensus 2531 98.99
KOG4260|consensus350 98.9
KOG4260|consensus350 98.9
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.89
KOG1225|consensus 525 98.83
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 98.81
KOG1225|consensus 525 98.71
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 98.39
KOG1226|consensus 783 98.37
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.36
smart0017939 EGF_CA Calcium-binding EGF-like domain. 98.32
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 98.07
PF0000832 EGF: EGF-like domain This is a sub-family of the P 98.01
KOG1226|consensus 783 97.81
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.8
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.79
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.75
PF1266224 cEGF: Complement Clr-like EGF-like 97.65
cd0005336 EGF Epidermal growth factor domain, found in epide 97.57
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.56
PF1266224 cEGF: Complement Clr-like EGF-like 97.55
smart0018135 EGF Epidermal growth factor-like domain. 97.48
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.42
cd0005336 EGF Epidermal growth factor domain, found in epide 96.86
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 96.81
smart0018135 EGF Epidermal growth factor-like domain. 96.79
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 96.57
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.25
KOG0994|consensus 1758 96.06
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 95.86
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 95.83
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 95.71
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 94.8
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 94.44
KOG0994|consensus 1758 93.55
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 93.53
KOG1836|consensus 1705 92.25
PF0168352 EB: EB module; InterPro: IPR006149 The EB domain h 88.57
smart0005163 DSL delta serrate ligand. 87.92
KOG1836|consensus 1705 86.88
PHA03099139 epidermal growth factor-like protein (EGF-like pro 86.58
PF12955103 DUF3844: Domain of unknown function (DUF3844); Int 85.15
>KOG1214|consensus Back     alignment and domain information
Probab=99.96  E-value=2.1e-29  Score=231.23  Aligned_cols=244  Identities=31%  Similarity=0.698  Sum_probs=200.9

Q ss_pred             CccceEEEEEEC-CCCeEEEeEeeeccCccCCeeeeEEEeeccCCcccCCcceeecceeeeeec----------------
Q psy5750           1 GVFNYSAELIFS-TGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHS----------------   63 (286)
Q Consensus         1 g~~~~~~~~~~~-~~~~~~~~~~~~g~~~~~~~~~~~~~~g~~p~~~~~~~~~~~~~~~~~~~~----------------   63 (286)
                      +.|+|.+++.|. +...++|+|++.|+|.+.+|++++.++|.+|.++.+...++.+|++.|++.                
T Consensus       541 ~~ftr~~evtf~g~~~~~vi~q~~~g~d~~~~l~ikt~~~G~vp~~p~~~~~hi~py~elyHys~s~vtstssr~y~~t~  620 (1289)
T KOG1214|consen  541 AAFTRDMEVTFYGGEETVVITQTAEGLDPENYLSIKTNIQGQVPYVPANFTAHISPYKELYHYSDSTVTSTSSRDYSLTF  620 (1289)
T ss_pred             cccccCceEEecCCcceeeeeeecCCCCCCceEEEecccccccceeccccccccCcchhhhhcccceeecccccceeeec
Confidence            468999999999 678899999999999999999999999999999999999999999988773                


Q ss_pred             -------------------------------------------------------------------CcCCCCCCC--CC
Q psy5750          64 -------------------------------------------------------------------STVNDDPCK--NF   74 (286)
Q Consensus        64 -------------------------------------------------------------------~~~~~~~C~--~~   74 (286)
                                                                                         .....++|-  ++
T Consensus       621 ga~~S~~~sy~~hq~ityq~C~h~~~~p~~p~tqql~vd~vfalyn~ee~~lr~a~Sn~igpV~E~S~~~~~npCy~gsh  700 (1289)
T KOG1214|consen  621 GAINSQTWSYRIHQNITYQVCRHAPRHPSFPTTQQLNVDRVFALYNDEERVLRFAVSNQIGPVKEDSDPTPVNPCYDGSH  700 (1289)
T ss_pred             CcccccceeEEEeecceeEEeecCCCCCCCCCceEeecccceeccCccccchhhhhhhcccceecCCCCcccccceecCc
Confidence                                                                               011223332  25


Q ss_pred             CCCCCCeeeeCC-CCCeEecCCCcccccccccCCCCCCCccCCCcCCCCCCCCCCCeeecCCCCeeEeCCCCcc--cCCC
Q psy5750          75 FCVANSSCIVED-DKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFT--GNGH  151 (286)
Q Consensus        75 ~C~~~~~C~~~~-g~~~C~C~~g~~~~~c~~~~~~~~~C~~~~~C~~~~~~C~~~~~C~~~~g~~~C~C~~G~~--g~~~  151 (286)
                      .|..++.|.... -.|+|.|..||.+        +++.|.++++|+.+.+.|..+++|++.+++|+|.|..||.  +++.
T Consensus       701 ~cdt~a~C~pg~~~~~tcecs~g~~g--------dgr~c~d~~eca~~~~~CGp~s~Cin~pg~~rceC~~gy~F~dd~~  772 (1289)
T KOG1214|consen  701 MCDTTARCHPGTGVDYTCECSSGYQG--------DGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRH  772 (1289)
T ss_pred             ccCCCccccCCCCcceEEEEeeccCC--------CCCCCCChhhhccCCCCCCCCceeecCCCceeEEEeecceeccCCc
Confidence            577778888773 4789999999985        4889999999999889999999999999999999999876  6778


Q ss_pred             ceecccCCCCCCCCCCCCCCCCCCCCCCcc--cc-CCCCceeeCCCCCCCCCCCCcccCCccccCCCcCCCCCCCCCCCe
Q psy5750         152 QCTEITVPQTGPTSPCESDPRACNPPHSTC--TN-LTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNAD  228 (286)
Q Consensus       152 ~C~~~~~~~~~~~~~C~~~~~~C~~~~~~C--~~-~~g~~~C~C~~G~~g~~~~~~~~~~~C~d~deC~~~~~~C~~~~~  228 (286)
                      +|..+..+  ..++.|..+.+.| ...+.|  +. ..+.|.|.|.+||.|++.       .|.|+|||..+  .|++++.
T Consensus       773 tCV~i~~p--ap~n~Ce~g~h~C-~i~g~a~c~~hGgs~y~C~CLPGfsGDG~-------~c~dvDeC~ps--rChp~A~  840 (1289)
T KOG1214|consen  773 TCVLITPP--APANPCEDGSHTC-AIAGQARCVHHGGSTYSCACLPGFSGDGH-------QCTDVDECSPS--RCHPAAT  840 (1289)
T ss_pred             ceEEecCC--CCCCccccCcccc-CcCCceEEEecCCceEEEeecCCccCCcc-------ccccccccCcc--ccCCCce
Confidence            89765432  3467888877888 666554  44 446899999999999966       89999999965  5999999


Q ss_pred             eeeCCCCeeeecCCCCcCCCCCcCCCCeeecccccccccc
Q psy5750         229 CINRPGTYQCQCKRGFSGDGFNCEEGKYCLVVGITLCKMY  268 (286)
Q Consensus       229 C~n~~g~y~C~C~~Gy~gdg~~C~~~~~c~~~~~~~c~~~  268 (286)
                      |+|++|+|.|+|.+||+|||+.|--. .   ..++.|+..
T Consensus       841 CyntpgsfsC~C~pGy~GDGf~CVP~-~---~~~T~C~~e  876 (1289)
T KOG1214|consen  841 CYNTPGSFSCRCQPGYYGDGFQCVPD-T---SSLTPCEQE  876 (1289)
T ss_pred             EecCCCcceeecccCccCCCceecCC-C---ccCCccccc
Confidence            99999999999999999999999322 1   124556654



>KOG1214|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>smart00682 G2F G2 nidogen domain and fibulin Back     alignment and domain information
>PF07474 G2F: G2F domain; InterPro: IPR006605 Basement membranes are sheet-like extracellular matrices found at the basal surfaces of epithelia and condensed mesenchyma Back     alignment and domain information
>cd00255 nidG2 Nidogen, G2 domain; Nidogen is an important component of the basement membrane, an extracellular sheet-like matrix Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 1e-09
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 3e-09
2bo2_A143 Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune Syst 7e-07
2w86_A147 Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 2e-05
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure

Iteration: 1

Score = 60.1 bits (144), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 22/133 (16%) Query: 114 DINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCTEITVPQTGPTSPCESDPRA 173 D++EC+ G + C C N +GS+ CQC G+TG EI V + ++PC++D Sbjct: 4 DVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPR---CEIDVNEC-VSNPCQND--- 56 Query: 174 CNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFVCTDVDECMNYPPICNNNADCINRP 233 +TC + C C PGY+ + + + DEC + P C +N C+++ Sbjct: 57 -----ATCLDQIGEFQCICMPGYEGVHCE--------VNTDECASSP--CLHNGRCLDKI 101 Query: 234 GTYQCQCKRGFSG 246 +QC+C GF+G Sbjct: 102 NEFQCECPTGFTG 114
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|2BO2|A Chain A, Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune System Molecule, In Complex With Calcium. Length = 143 Back     alignment and structure
>pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 5e-22
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 3e-16
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 7e-10
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-08
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-04
2bou_A143 EGF-like module containing mucin-like hormone rece 1e-21
2bou_A143 EGF-like module containing mucin-like hormone rece 7e-14
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-18
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-10
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 4e-17
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-09
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 6e-17
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-10
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 4e-08
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-14
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 6e-09
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 2e-14
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 6e-07
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 7e-04
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 9e-13
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 4e-10
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-06
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 1e-12
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 3e-06
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 2e-12
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 2e-06
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 4e-04
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 7e-12
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-11
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-08
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 4e-06
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-11
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 5e-10
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 8e-09
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 1e-08
2vh0_B134 Activated factor XA light chain; serine protease, 9e-10
2vh0_B134 Activated factor XA light chain; serine protease, 3e-09
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-08
1aut_L114 Activated protein C; serine proteinase, plasma cal 4e-06
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-05
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-08
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-07
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-04
3v65_B 386 Low-density lipoprotein receptor-related protein; 2e-07
3v65_B 386 Low-density lipoprotein receptor-related protein; 9e-05
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 5e-07
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 1e-05
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 2e-06
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 3e-05
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-06
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 2e-05
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 1e-04
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-05
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-04
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 3e-05
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 4e-05
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 7e-05
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 1e-04
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 4e-04
1ob1_C99 Major merozoite surface protein; immune system, im 6e-04
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 6e-04
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 7e-04
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
 Score = 89.0 bits (221), Expect = 5e-22
 Identities = 32/165 (19%), Positives = 51/165 (30%), Gaps = 29/165 (17%)

Query: 90  TCICNRGFQQLYSEDRLQDDFGCFDINECNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGN 149
            C C   F+            GC D    N     C+ +     + G  +C    G   +
Sbjct: 25  ICDCPPDFE------LNPTRVGCVDTRSGN-----CYLDIRPRGDNGDTACSNEIGVGVS 73

Query: 150 GHQCTEITVPQTGPTSPCESDPRACNPPHSTCTNLTDYRTCNCDPGYQKDYLDDRRVAFV 209
              C                 P    P             C    G++ +      +  +
Sbjct: 74  KASCCCSLG-------KAWGTPCEMCP---AVNTSEYKILCPGGEGFRPNP-----ITVI 118

Query: 210 CTDVDECMNYPPICNNNADCINRPGTYQCQCKRGF--SGDGFNCE 252
             D+DEC   P +C     CIN  G++QC+C  G+  + D   C+
Sbjct: 119 LEDIDECQELPGLC-QGGKCINTFGSFQCRCPTGYYLNEDTRVCD 162


>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Length = 99 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Length = 105 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.89
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.88
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.87
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.83
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.83
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.82
2bou_A143 EGF-like module containing mucin-like hormone rece 99.78
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.78
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.75
2bou_A143 EGF-like module containing mucin-like hormone rece 99.75
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.72
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.67
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.65
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.61
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.57
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.56
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.55
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.55
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.54
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.54
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.51
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.42
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.41
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.4
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.4
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.38
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.33
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.33
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.31
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.31
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.29
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.28
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.28
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.28
2vh0_B134 Activated factor XA light chain; serine protease, 99.27
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.26
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.24
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.23
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.21
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.21
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.19
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.19
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.18
2vh0_B134 Activated factor XA light chain; serine protease, 99.17
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 99.12
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 99.1
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 99.09
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 99.06
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.05
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.97
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.94
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.9
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.85
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.73
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.69
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.69
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.68
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.67
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.64
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.61
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.59
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.56
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.49
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 98.45
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.44
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 98.43
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.39
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.35
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.32
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.31
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.29
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 98.21
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.19
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.13
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.13
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.12
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.05
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.0
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.98
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.9
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.89
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.89
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.83
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 97.82
1ob1_C99 Major merozoite surface protein; immune system, im 97.8
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.79
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.79
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.78
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.75
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.67
1ob1_C99 Major merozoite surface protein; immune system, im 97.64
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.62
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 97.6
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.6
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.44
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.43
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.41
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.38
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.27
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.25
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.15
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.12
1szb_A170 Mannose binding lectin-associated serine protease- 97.1
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 97.03
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 96.83
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 96.8
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 96.69
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.64
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 96.38
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.32
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 96.31
1nzi_A159 Complement C1S component; calcium, innate immunity 96.26
2wph_E59 Coagulation factor IXA light chain; serine proteas 96.2
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 96.2
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.13
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.1
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 96.02
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 95.74
1szb_A170 Mannose binding lectin-associated serine protease- 95.51
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 95.44
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 94.99
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 94.98
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 94.92
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 94.57
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 94.44
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 94.44
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 94.13
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 94.12
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 93.99
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 93.4
2i9a_A145 Urokinase-type plasminogen activator; growth facto 93.28
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 93.18
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 93.14
1nzi_A159 Complement C1S component; calcium, innate immunity 92.97
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 92.91
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 92.64
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 92.37
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 92.36
3fby_A 551 COMP, cartilage oligomeric matrix protein; signatu 92.24
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 92.14
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 91.56
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 91.48
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 91.15
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 90.37
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 90.35
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 89.59
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 89.54
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 88.41
2i9a_A145 Urokinase-type plasminogen activator; growth facto 87.41
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 87.39
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 85.63
3fby_A 551 COMP, cartilage oligomeric matrix protein; signatu 83.36
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
Probab=99.89  E-value=1.8e-24  Score=175.49  Aligned_cols=149  Identities=27%  Similarity=0.646  Sum_probs=125.0

Q ss_pred             CCCCCCCCCeeeeCCCCCeEecCCCcccccccccCCCCCCCccCCCcCCC--CCCCCCCCeeecCC-----CCeeEeCCC
Q psy5750          72 KNFFCVANSSCIVEDDKPTCICNRGFQQLYSEDRLQDDFGCFDINECNAG--TDLCHKNAMCFNEI-----GSYSCQCRP  144 (286)
Q Consensus        72 ~~~~C~~~~~C~~~~g~~~C~C~~g~~~~~c~~~~~~~~~C~~~~~C~~~--~~~C~~~~~C~~~~-----g~~~C~C~~  144 (286)
                      ..+||. +++|++..++|+|.|++||++.       ++..|.++++|...  .++|.+++.|++..     ++|+|.|++
T Consensus         9 ~~~pC~-ng~C~~~~g~~~C~C~~G~~g~-------~~~~C~~id~C~~~~~~~~C~~~~~C~~~~~~~~~g~y~C~C~~   80 (186)
T 1z1y_A            9 VDTICX-NGQLVQMSNHFXCMCNEGLVHL-------SENTCEEXNECXXETLGXACGEFGQCIENPDPAQVNMYXCGCIE   80 (186)
T ss_dssp             TTCCCB-TEEEEECSSCEEEEECTTEEEE-------ETTEEEECCCCSGGGTTSEEETTEEEEECSSTTSSCSEEEEECT
T ss_pred             CCCCCC-CCEeECCCCCeEeECCCCCccC-------CCCccCCCCcccCCCCCCCCCCCCEeecCCCCcCCCCEECCCCC
Confidence            447888 4699999999999999999976       25678899999843  37899999999998     899999999


Q ss_pred             CcccCCCceecccCCCCCCCCCCCCCCCCCCCCCCccc----cCCCCceeeCCCCCCCCCCCCcccCCccccC--CCcCC
Q psy5750         145 GFTGNGHQCTEITVPQTGPTSPCESDPRACNPPHSTCT----NLTDYRTCNCDPGYQKDYLDDRRVAFVCTDV--DECMN  218 (286)
Q Consensus       145 G~~g~~~~C~~~~~~~~~~~~~C~~~~~~C~~~~~~C~----~~~g~~~C~C~~G~~g~~~~~~~~~~~C~d~--deC~~  218 (286)
                      ||+|+...|.         +++|..  .+| .+++.|+    +..++|+|.|++||+|..    .++..|+++  ++|..
T Consensus        81 G~~g~~~~C~---------~d~C~~--~~C-~~~g~C~~~~~~~~g~~~C~C~~Gy~g~~----~~~~~C~~~~~~~C~~  144 (186)
T 1z1y_A           81 GYTLXEDTCV---------LDVCQY--XNC-GESGECIVEYLSEIQSAGCSCAIGXVPNP----EDEXXCTXTGETACQL  144 (186)
T ss_dssp             TEEEETTEEE---------EGGGTT--CCC-CTTEEEEEEEETTEEEEEEEECTEEEEET----TTTTEEEEEECCCCCC
T ss_pred             CCccCCCCCC---------CCcCcC--CCC-CCCCEEeeCCcCCCCCceEECCCCCcccC----CCCCcceEcCCCcccc
Confidence            9998655665         478887  579 8889998    888899999999999832    012278765  89974


Q ss_pred             CCCCC-CCCCeeeeCCCCeeeecCCCCcCC
Q psy5750         219 YPPIC-NNNADCINRPGTYQCQCKRGFSGD  247 (286)
Q Consensus       219 ~~~~C-~~~~~C~n~~g~y~C~C~~Gy~gd  247 (286)
                         .| .++++|+|++++|+|.|++||+|+
T Consensus       145 ---~C~~~~~~C~n~~g~y~C~C~~G~~g~  171 (186)
T 1z1y_A          145 ---XCNTDNEVCXNVEGVYXCQCMEGFTFD  171 (186)
T ss_dssp             ---CCCTTTEEEEEETTEEEEEECTTCEEE
T ss_pred             ---cccccCcceecCCCCeeeECCCCCccC
Confidence               59 889999999999999999999998



>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 286
d1gl4a240 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 2e-09
d1gl4a240 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 3e-06
d1gl4a1233 d.22.1.2 (A:399-631) Domain G2 of nidogen-1 {Mouse 3e-08
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 1e-07
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 2e-07
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-07
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 6e-07
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 2e-06
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 3e-06
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 1e-05
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 2e-05
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 2e-05
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 5e-05
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-05
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 3e-05
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 7e-05
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 4e-05
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 1e-04
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 4e-05
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 0.001
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 1e-04
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 6e-04
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 2e-04
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 3e-04
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 4e-04
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 0.004
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 9e-04
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 0.001
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 0.001
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 0.002
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.003
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 0.004
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-like domain of nidogen-1
domain: EGF-like domain of nidogen-1
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 50.2 bits (120), Expect = 2e-09
 Identities = 12/37 (32%), Positives = 17/37 (45%)

Query: 118 CNAGTDLCHKNAMCFNEIGSYSCQCRPGFTGNGHQCT 154
           C      C  +A C +    + C+C   +TGNG QC 
Sbjct: 2   CANNRHQCSVHAECRDYATGFCCRCVANYTGNGRQCV 38


>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1gl4a1 d.22.1.2 (A:399-631) Domain G2 of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 233 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d1gl4a1233 Domain G2 of nidogen-1 {Mouse (Mus musculus) [TaxI 99.19
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 99.12
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.95
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 98.92
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.92
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.91
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.9
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.88
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.84
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.78
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.78
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.78
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.75
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.74
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.72
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.71
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.64
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.63
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.62
d1nt0a345 Mannose-binding protein associated serine protease 98.56
d1szba245 Mannose-binding protein associated serine protease 98.52
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.52
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.51
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.47
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.46
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.41
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 98.39
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.39
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.36
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.34
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.33
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.29
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.25
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.24
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.24
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.22
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.21
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.19
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.17
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.11
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.08
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.03
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.92
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.79
d1szba245 Mannose-binding protein associated serine protease 97.74
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.72
d1nt0a345 Mannose-binding protein associated serine protease 97.7
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.65
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.55
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.47
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.45
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.38
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.37
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.34
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.28
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.27
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.22
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.04
d1ijqa250 Low density lipoprotein (LDL) receptor, different 96.97
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 96.53
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 96.2
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 96.14
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 96.06
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.96
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 95.45
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 95.3
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 95.16
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 95.11
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 94.88
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 94.55
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 94.35
d1ijqa250 Low density lipoprotein (LDL) receptor, different 94.27
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 93.17
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 91.44
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 89.78
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 89.08
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 88.8
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 88.28
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 81.26
>d1gl4a1 d.22.1.2 (A:399-631) Domain G2 of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: GFP-like
superfamily: GFP-like
family: Domain G2 of nidogen-1
domain: Domain G2 of nidogen-1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.19  E-value=1.3e-11  Score=98.82  Aligned_cols=63  Identities=27%  Similarity=0.446  Sum_probs=60.4

Q ss_pred             CccceEEEEEEC-CCCeEEEeEeeeccCccCCeeeeEEEeeccCCcccCCcceeecceeeeeec
Q psy5750           1 GVFNYSAELIFS-TGQRLHVQEEFFGHDVYDQLKMQGSIQGTAPSIAVGVSPVLEDLQQEFTHS   63 (286)
Q Consensus         1 g~~~~~~~~~~~-~~~~~~~~~~~~g~~~~~~~~~~~~~~g~~p~~~~~~~~~~~~~~~~~~~~   63 (286)
                      |.|+|+++|+|. +++.|+|+|+|.|+|.++.|.+++.+.|.+|.+++++.+++.||.|.|+..
T Consensus        86 G~F~~~s~v~F~~~~~~l~i~q~~~GlD~~~~L~v~~~i~G~VP~i~~~a~v~i~dY~E~Y~~~  149 (233)
T d1gl4a1          86 GEFTRQAEVTFLGHPGKLVLKQQFSGIDEHGHLTISTELEGRVPQIPYGASVHIEPYTELYHYS  149 (233)
T ss_dssp             TEEEEEEEEEETTSSSCEEEEEEEECBCTTSCEECEEEEEEEECCCCTTCEEECCCEEEEEEEE
T ss_pred             eEEEEEEEEEEcCCCcEEEEEEEEEccCcCCeEEEEEEEEeEcCCCCCCCEEEeCCceEEEEeC
Confidence            789999999997 889999999999999999999999999999999999999999999999653



>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure