Diaphorina citri psyllid: psy5752


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MVKVPIRFSLSECDTPCHPNAQCTSPDEFNESREQAKCICNFGYTGDGVTECNPESLGCNVVKNCHANAECVYNATSAGYRCQCAQGYVGNGVECHPLKSCLEDRSLCGKDSQGYVGNGVECHPLKSCLEDRSLCGKDASCVVASQGHFHCECNEGFTGNGITCKPVRKKESDFLLVNQGMFMLRVPYQPTRTDRGRPIINHPNQMLIGLCLSPCVLCVLQY
cccccccccccccccccccccccccccccccccccEEEEcccccCCcccccccccccccccccccccccccEEccccccEEEEcccccccccccccccccccccccccccccccccccccECcccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccEEECccccccccccccccccccccccccccccccccccccc
*V*VPIRFSLSECDTPCHPNAQCTSPDEFNESREQAKCICNFGYTGDGVTECNPESLGCNVVKNCHANAECVYNATSAGYRCQCAQGYVGNGVECHPLKSCLEDRSLCGKDSQGYVGNGVECHPLKSCLEDRSLCGKDASCVVASQGHFHCECNEGFTGNGITCKPVRKKESDFLLVNQGMFMLRVPYQPTRTDRGRPIINHPNQMLIGLCLSPCVLCVLQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKVPIRFSLSECDTPCHPNAQCTSPDEFNESREQAKCICNFGYTGDGVTECNPESLGCNVVKNCHANAECVYNATSAGYRCQCAQGYVGNGVECHPLKSCLEDRSLCGKDSQGYVGNGVECHPLKSCLEDRSLCGKDASCVVASQGHFHCECNEGFTGNGITCKPVRKKESDFLLVNQGMFMLRVPYQPTRTDRGRPIINHPNQMLIGLCLSPCVLCVLQY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0008150 [BP]biological_processprobable
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YO8, chain A
Confidence level:very confident
Coverage over the Query: 11-102,117-171
View the alignment between query and template
View the model in PyMOL
Template: 1YO8, chain A
Confidence level:very confident
Coverage over the Query: 58-93,121-192
View the alignment between query and template
View the model in PyMOL
Template: 4A0P, chain A
Confidence level:probable
Coverage over the Query: 124-214
View the alignment between query and template
View the model in PyMOL