Diaphorina citri psyllid: psy5765

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
TFGTCVVEKALNLGPSGRLRYLGPSGSLRYLGPSGSLRYLGPSGRLRYLGPSGSLRYLGPSGRLRYLGPSGRLRYLGPSGSLRYLGPSGRLRYLGPSGRLRYLGPSGRLRYLGPSGRLRYLGPSGRLNSDGPSGRLRYLGPSGRLRYLGPSGRLRYLGPSGRLRYLGPSGRLRYLGPSGRLRYLGPSGRLRYLGLSDGLRVSGLH
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
TFGTCVVEKALNLGPSG**************************************************************************************************************************************************************GPSG*LR**GPSGRLRYLGLS*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TFGTCVVEKALNLGPSGRLRYLGPSGSLRYLGPSGSLRYLGPSGRLRYLGPSGSLRYLGPSGRLRYLGPSGRLRYLGPSGSLRYLGPSGRLRYLGPSGRLRYLGPSGRLRYLGPSGRLRYLGPSGRLNSDGPSGRLRYLGPSGRLRYLGPSGRLRYLGPSGRLRYLGPSGRLRYLGPSGRLRYLGPSGRLRYLGLSDGLRVSGLH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070208 [BP]protein heterotrimerizationprobableGO:0051259, GO:0022607, GO:0070206, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051291, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0048407 [MF]platelet-derived growth factor bindingprobableGO:0003674, GO:0019838, GO:0005515, GO:0005488
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005583 [CC]fibrillar collagenprobableGO:0005581, GO:0044421, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0005578
GO:0043227 [CC]membrane-bounded organelleprobableGO:0005575, GO:0043226
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0022603 [BP]regulation of anatomical structure morphogenesisprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0071363 [BP]cellular response to growth factor stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0070848, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0071230 [BP]cellular response to amino acid stimulusprobableGO:1901700, GO:0043200, GO:0051716, GO:0009719, GO:1901701, GO:1901698, GO:0071417, GO:1901699, GO:0008150, GO:0044699, GO:0071229, GO:0071495, GO:0071310, GO:0044763, GO:0001101, GO:0070887, GO:0050896, GO:0042221, GO:0009987, GO:0010243, GO:0010033

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted