Diaphorina citri psyllid: psy5769

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----

MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQRHLGGPWKILGTLTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLVKKDKPGLDTAALHKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLPRSI

cHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEECccccccccccccccHHHHHHHHHHccccccccccccHHHcccHHHHHHHHHHcccccccccccccccEEEEEccccccccccHHHHHHcccccccccccCEEEECccccccccECccccHHHHHHHHHHccEECccccccccccccccHHHHHHHHHHHHcHHcccccccccccCCcccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccccccCEEccccccccccccHHHHHHHHHHHHHcccccccccccccHHHHccccccccEEECccccHHHHHHHHHHHHHHHHcccccccccccc

MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQRHLGGPWKILGTLTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDK******QYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLVKKDKPGLDTAALHKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLPR**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial	Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).	confident	P21914
Succinate dehydrogenase iron-sulfur subunit		confident	Q68XS0
Succinate dehydrogenase iron-sulfur subunit		confident	Q4UN71

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005749 [CC]	mitochondrial respiratory chain complex II	confident	GO:0044464, GO:0031975, GO:0043229, GO:0005739, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0045283, GO:0044444, GO:0045281, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0045273, GO:0045257, GO:0032991, GO:0043231, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0005740, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0048039 [MF]	ubiquinone binding	probable	GO:0003674, GO:0048038, GO:0048037, GO:0005488
GO:0006121 [BP]	mitochondrial electron transport, succinate to ubiquinone	probable	GO:0044710, GO:0015980, GO:0006793, GO:0016310, GO:0009987, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042775, GO:0042773, GO:0055114, GO:0006119
GO:0051538 [MF]	3 iron, 4 sulfur cluster binding	probable	GO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0051539 [MF]	4 iron, 4 sulfur cluster binding	probable	GO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0051537 [MF]	2 iron, 2 sulfur cluster binding	probable	GO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0008177 [MF]	succinate dehydrogenase (ubiquinone) activity	probable	GO:0016627, GO:0016635, GO:0003824, GO:0003674, GO:0000104, GO:0016491
GO:0008270 [MF]	zinc ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0030445 [CC]	yeast-form cell wall	probable	GO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944, GO:0009277
GO:0009055 [MF]	electron carrier activity	probable	GO:0003674
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0006099 [BP]	tricarboxylic acid cycle	probable	GO:0044238, GO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0009060, GO:0008150, GO:0008152, GO:0045333, GO:0006091, GO:0055114
GO:0006105 [BP]	succinate metabolic process	probable	GO:0043648, GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.3.-.-	Acting on the CH-CH group of donors.	probable
1.3.5.-	With a quinone or related compound as acceptor.	probable
1.3.5.1	11-cis-retinol dehydrogenase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VR8, chain B
Confidence level:very confident
Coverage over the Query: 1-51,156-314
View the alignment between query and template
View the model in PyMOL

Template: 3VR8, chain B
Confidence level:very confident
Coverage over the Query: 120-150
View the alignment between query and template
View the model in PyMOL

Template: 2BS2, chain B
Confidence level:very confident
Coverage over the Query: 326-363
View the alignment between query and template
View the model in PyMOL