Psyllid ID: psy5769

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQRHLGGPWKILGTLTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLVKKDKPGLDTAALHKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLPRSI
cHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccHHHHHHHHHHccccccccccccHHHcccHHHHHHHHHHHccccccccccccccEEEEEccccccccccHHHHHHcccccccccccEEEEEEccccccccEEccccHHHHHHHHHHccEEEccccccccccccccHHHHHHHHHHHHcHHcccccccccccEEcccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccccccEEEccccccccccccHHHHHHHHHHHHHcccccccccccccHHHHccccccccEEEEccccHHHHHHHHHHHHHHHHcccccccccccc
cHHHHHHHHHHHcccccccccccccccccccEEEEccEEEEHHEEEcccccccEEEEcccccHHHHcccHcHHHHHHHHHHccHHHcccccccccHHHcccEEEEEEEccccccccccccccEEEEEEEEccccccccccHEEEEEEEccccccccccEEEEcccccHHHHHcHHcHHHHHHHHHHccHHHcccccccccccccccHHHHHHHccHHHHEEHHcccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHccccEEEEEcEEcccHccccccccHHHHHHHHHHHHHHHHHccccccccEEEEccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHccc
MVLDALIKIknemdptltfrrscregicgscamniggvnTLACISKIdandkvskiyplphmyvvkdlvpdmnNFYAQYKSIQrhlggpwkiLGTLTAKNIRSFQLsaaassavpaekpakykTFAIYrwnpdkpdekptmQEYKVDLnnkidandkvskiyplphmyvvkdlvpdmnNFYAQYKSIQpwlqrdkenignaqylqslddrkkldglyecilcaccstscpsywwngekylgpAVLMQAYRWIIDSRDEKTADRLnqlkdpfsvyrchtimnctrtcpkglnpGRAIAEIKKLLSGlvkkdkpgldtaALHKidandkvskiyplphmyvvkdlvpdmnNFYAQYKsiqpwlprsi
MVLDALIkiknemdptltFRRSCREGICGSCAMNIGGVNTLACISKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQRHLGGPWKILGTLTAKNIRSFQLSaaassavpaekpakykTFAIyrwnpdkpdekPTMQEYKVDLNNKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLnqlkdpfsvyrchTIMNCTrtcpkglnpGRAIAEIKKLLSGLVKKDKPGLDTAalhkidandkvskiypLPHMYVVKDLVPDMNNFYAQyksiqpwlprsi
MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQRHLGGPWKILGTLTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLVKKDKPGLDTAALHKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLPRSI
****ALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQRHLGGPWKILGTLTAKNIRSFQLSAA**********AKYKTFAIYRWN**************VDLNNKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLVKKDKPGLDTAALHKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWL****
MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQRH******************FQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRD******************LDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLVKKDKPGLDTAALHKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLPR**
MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQRHLGGPWKILGTLTAKNIRSFQL***********KPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLVKKDKPGLDTAALHKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLPRSI
MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQRHLGGPWKILGTLTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDK******QYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLVKKDKPGLDTAALHKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLPRS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQRHLGGPWKILGTLTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLVKKDKPGLDTAALHKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLPRSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query365 2.2.26 [Sep-21-2011]
P21914297 Succinate dehydrogenase [ yes N/A 0.616 0.757 0.584 3e-87
P21913282 Succinate dehydrogenase [ yes N/A 0.575 0.744 0.565 3e-78
Q9YHT2290 Succinate dehydrogenase [ yes N/A 0.534 0.672 0.573 5e-78
P21912280 Succinate dehydrogenase [ yes N/A 0.6 0.782 0.537 1e-77
Q9CQA3282 Succinate dehydrogenase [ yes N/A 0.580 0.751 0.544 3e-77
Q007T0280 Succinate dehydrogenase [ yes N/A 0.583 0.760 0.542 4e-77
Q3B8J8282 Succinate dehydrogenase [ N/A N/A 0.504 0.652 0.606 4e-77
A5PL98280 Succinate dehydrogenase [ yes N/A 0.520 0.678 0.591 2e-76
Q3T189280 Succinate dehydrogenase [ yes N/A 0.580 0.757 0.549 2e-76
B0BM36284 Succinate dehydrogenase [ yes N/A 0.504 0.647 0.602 3e-76
>sp|P21914|DHSB_DROME Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Drosophila melanogaster GN=SdhB PE=2 SV=2 Back     alignment and function desciption
 Score =  322 bits (825), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 169/289 (58%), Positives = 189/289 (65%), Gaps = 64/289 (22%)

Query: 93  LGTLTAKNIRSFQLSAAASSAVPAEKPAK--------YKTFAIYRWNPDKPDEKPTMQEY 144
           +G+L A+N    Q+ A ++     E+ A+         K F IYRWNPD   EKP MQ Y
Sbjct: 13  VGSLVARN----QMRAISNGTAQLEQQAQPKEAQEPQIKKFEIYRWNPDNAGEKPYMQTY 68

Query: 145 KVDLN------------------------------------------------NKIDAND 156
           +VDL                                                 +KID N 
Sbjct: 69  EVDLRECGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDINT 128

Query: 157 KVS-KIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKE---NIGNAQYLQSLDDRKK 212
             S K+YPLPHMYVV+DLVPDMNNFY QY++IQPWLQR  E     G AQYLQS++DR K
Sbjct: 129 SKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAGEKKGKAQYLQSVEDRSK 188

Query: 213 LDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFS 272
           LDGLYECILCACCSTSCPSYWWN EKYLGPAVLMQAYRWIIDSRDE +A+RLN+LKDPFS
Sbjct: 189 LDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDENSAERLNKLKDPFS 248

Query: 273 VYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLVKKDKPGLDTAALHK 321
           VYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGL  K  P L+TAALHK
Sbjct: 249 VYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPAPKLETAALHK 297
Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 3EC: .EC: 5EC: .EC: 1
>sp|P21913|DHSB_RAT Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Rattus norvegicus GN=Sdhb PE=2 SV=2 Back     alignment and function description
>sp|Q9YHT2|DHSB_CHICK Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Gallus gallus GN=SDHB PE=1 SV=1 Back     alignment and function description
>sp|P21912|DHSB_HUMAN Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Homo sapiens GN=SDHB PE=1 SV=3 Back     alignment and function description
>sp|Q9CQA3|DHSB_MOUSE Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Mus musculus GN=Sdhb PE=1 SV=1 Back     alignment and function description
>sp|Q007T0|DHSB_PIG Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Sus scrofa GN=SDHB PE=1 SV=1 Back     alignment and function description
>sp|Q3B8J8|DHSB_XENLA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Xenopus laevis GN=sdhb PE=2 SV=1 Back     alignment and function description
>sp|A5PL98|DHSB_DANRE Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Danio rerio GN=sdhb PE=2 SV=1 Back     alignment and function description
>sp|Q3T189|DHSB_BOVIN Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Bos taurus GN=SDHB PE=2 SV=1 Back     alignment and function description
>sp|B0BM36|DHSB_XENTR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Xenopus tropicalis GN=sdhb PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
67043769279 succinate dehydrogenase iron sulfur subu 0.591 0.774 0.636 2e-92
383865283277 PREDICTED: succinate dehydrogenase [ubiq 0.586 0.772 0.618 5e-89
283046834283 succinate dehydrogenase [ubiquinone] iro 0.6 0.773 0.615 1e-87
350398725277 PREDICTED: succinate dehydrogenase [ubiq 0.583 0.768 0.613 2e-87
312384972 658 hypothetical protein AND_01318 [Anophele 0.536 0.297 0.658 3e-87
158285891290 AGAP007309-PA [Anopheles gambiae str. PE 0.536 0.675 0.666 3e-87
340712067277 PREDICTED: succinate dehydrogenase [ubiq 0.583 0.768 0.609 1e-86
289742779297 succinate dehydrogenase Fe-s protein sub 0.572 0.703 0.641 3e-86
157125918289 succinate dehydrogenase [Aedes aegypti] 0.536 0.678 0.658 5e-86
194758066297 GF11072 [Drosophila ananassae] gi|190622 0.627 0.771 0.596 8e-86
>gi|67043769|gb|AAY63983.1| succinate dehydrogenase iron sulfur subunit B [Lysiphlebus testaceipes] Back     alignment and taxonomy information
 Score =  345 bits (884), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 173/272 (63%), Positives = 197/272 (72%), Gaps = 56/272 (20%)

Query: 99  KNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLN--------- 149
           K +RSF +SA  ++       A+ KTF+IYRWNPDKPD+KPTMQEYKVDLN         
Sbjct: 13  KQVRSFHVSAVQNAE------ARLKTFSIYRWNPDKPDDKPTMQEYKVDLNKCGPMVLDA 66

Query: 150 -----NKIDAN-----------------------------------DKVSKIYPLPHMYV 169
                N+ID +                                    K SKIYPLPHMY+
Sbjct: 67  LIKIKNEIDPSLTFRRSCREGICGSCAMNIGGTNTLACISKIDNDTSKKSKIYPLPHMYI 126

Query: 170 VKDLVPDMNNFYAQYKSIQPWLQRD-KENIGNAQYLQSLDDRKKLDGLYECILCACCSTS 228
           VKDLVPDM+NFYAQYKSIQPWLQRD  + +G  QYLQS++DRKKLDGLYECILCACCSTS
Sbjct: 127 VKDLVPDMSNFYAQYKSIQPWLQRDDNKKVGTQQYLQSVEDRKKLDGLYECILCACCSTS 186

Query: 229 CPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPK 288
           CPSYWWNG+KYLGPAVLMQAYRWIIDSRD KT DRL++L+DPFSVYRCHTIMNCTRTCPK
Sbjct: 187 CPSYWWNGDKYLGPAVLMQAYRWIIDSRDTKTTDRLDKLRDPFSVYRCHTIMNCTRTCPK 246

Query: 289 GLNPGRAIAEIKKLLSGLVKKDKPGLDTAALH 320
           GLNPG+AI+EIKKLL  +++K KPGLDT ALH
Sbjct: 247 GLNPGKAISEIKKLLGSVIEKGKPGLDTTALH 278

Source: Lysiphlebus testaceipes

Species: Lysiphlebus testaceipes

Genus: Lysiphlebus

Family: Braconidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383865283|ref|XP_003708104.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|283046834|ref|NP_001164360.1| succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial [Tribolium castaneum] gi|270014261|gb|EFA10709.1| hypothetical protein TcasGA2_TC011988 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350398725|ref|XP_003485289.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|312384972|gb|EFR29572.1| hypothetical protein AND_01318 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158285891|ref|XP_308512.4| AGAP007309-PA [Anopheles gambiae str. PEST] gi|157020207|gb|EAA45422.4| AGAP007309-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|340712067|ref|XP_003394586.1| PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|289742779|gb|ADD20137.1| succinate dehydrogenase Fe-s protein subunit [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|157125918|ref|XP_001660815.1| succinate dehydrogenase [Aedes aegypti] gi|108873481|gb|EAT37706.1| AAEL010330-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|194758066|ref|XP_001961283.1| GF11072 [Drosophila ananassae] gi|190622581|gb|EDV38105.1| GF11072 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
FB|FBgn0014028297 SdhB "Succinate dehydrogenase 0.471 0.579 0.812 2.4e-87
UNIPROTKB|B0BM36284 sdhb "Succinate dehydrogenase 0.421 0.542 0.775 6.5e-81
UNIPROTKB|Q3B8J8282 sdhb "Succinate dehydrogenase 0.421 0.546 0.782 1.7e-80
ZFIN|ZDB-GENE-030131-8005280 sdhb "succinate dehydrogenase 0.441 0.575 0.773 7.4e-80
RGD|1308598282 Sdhb "succinate dehydrogenase 0.435 0.563 0.751 4.1e-79
UNIPROTKB|F1NNF7290 SDHB "Succinate dehydrogenase 0.435 0.548 0.757 1.1e-78
UNIPROTKB|Q3T189280 SDHB "Succinate dehydrogenase 0.435 0.567 0.751 1.4e-78
UNIPROTKB|Q007T0280 SDHB "Succinate dehydrogenase 0.435 0.567 0.751 1.7e-78
MGI|MGI:1914930282 Sdhb "succinate dehydrogenase 0.435 0.563 0.751 1.7e-78
UNIPROTKB|P21912280 SDHB "Succinate dehydrogenase 0.435 0.567 0.751 2.2e-78
FB|FBgn0014028 SdhB "Succinate dehydrogenase B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 779 (279.3 bits), Expect = 2.4e-87, Sum P(2) = 2.4e-87
 Identities = 143/176 (81%), Positives = 154/176 (87%)

Query:   150 NKIDANDKVS-KIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKE---NIGNAQYLQ 205
             +KID N   S K+YPLPHMYVV+DLVPDMNNFY QY++IQPWLQR  E     G AQYLQ
Sbjct:   122 SKIDINTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYRNIQPWLQRKNEAGEKKGKAQYLQ 181

Query:   206 SLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWIIDSRDEKTADRLN 265
             S++DR KLDGLYECILCACCSTSCPSYWWN EKYLGPAVLMQAYRWIIDSRDE +A+RLN
Sbjct:   182 SVEDRSKLDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDENSAERLN 241

Query:   266 QLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLVKKDKPGLDTAALHK 321
             +LKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGL  K  P L+TAALHK
Sbjct:   242 KLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLASKPAPKLETAALHK 297
GO:0008177 "succinate dehydrogenase (ubiquinone) activity" evidence=ISS;NAS
GO:0005749 "mitochondrial respiratory chain complex II" evidence=ISS;NAS
GO:0006099 "tricarboxylic acid cycle" evidence=ISS;NAS
GO:0009055 "electron carrier activity" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0006121 "mitochondrial electron transport, succinate to ubiquinone" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
UNIPROTKB|B0BM36 sdhb "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q3B8J8 sdhb "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8005 sdhb "succinate dehydrogenase complex, subunit B, iron sulfur (Ip)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1308598 Sdhb "succinate dehydrogenase complex, subunit B, iron sulfur (Ip)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNF7 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T189 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q007T0 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1914930 Sdhb "succinate dehydrogenase complex, subunit B, iron sulfur (Ip)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P21912 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P21801DHSB_YEAST1, ., 3, ., 5, ., 10.56650.50410.6917yesN/A
Q9CQA3DHSB_MOUSE1, ., 3, ., 5, ., 10.54470.58080.7517yesN/A
Q1RGP3DHSB_RICBR1, ., 3, ., 9, 9, ., 10.52780.50410.7049yesN/A
Q68XS0DHSB_RICTY1, ., 3, ., 9, 9, ., 10.71030.38350.5363yesN/A
A5PL98DHSB_DANRE1, ., 3, ., 5, ., 10.59160.52050.6785yesN/A
Q3T189DHSB_BOVIN1, ., 3, ., 5, ., 10.54960.58080.7571yesN/A
Q6FWS8DHSB_CANGA1, ., 3, ., 5, ., 10.5520.55060.7944yesN/A
Q007T0DHSB_PIG1, ., 3, ., 5, ., 10.54240.58350.7607yesN/A
Q09545DHSB_CAEEL1, ., 3, ., 5, ., 10.52300.51780.6342yesN/A
P21911DHSB_SCHPO1, ., 3, ., 5, ., 10.50750.57800.7672yesN/A
P21913DHSB_RAT1, ., 3, ., 5, ., 10.56530.57530.7446yesN/A
P21912DHSB_HUMAN1, ., 3, ., 5, ., 10.53760.60.7821yesN/A
P21914DHSB_DROME1, ., 3, ., 5, ., 10.58470.61640.7575yesN/A
Q92JJ8DHSB_RICCN1, ., 3, ., 9, 9, ., 10.51690.51230.7164yesN/A
Q4UN71DHSB_RICFE1, ., 3, ., 9, 9, ., 10.52340.50130.7011yesN/A
Q75CI4DHSB_ASHGO1, ., 3, ., 5, ., 10.56910.54240.7586yesN/A
Q8ZQU2DHSB_SALTY1, ., 3, ., 9, 9, ., 10.59440.38080.5840yesN/A
B0BM36DHSB_XENTR1, ., 3, ., 5, ., 10.60250.50410.6478yesN/A
Q9ZEA1DHSB_RICPR1, ., 3, ., 9, 9, ., 10.52340.50130.7011yesN/A
Q9YHT2DHSB_CHICK1, ., 3, ., 5, ., 10.57310.53420.6724yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.3.5.10.914
3rd Layer1.3.5LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
PLN00129276 PLN00129, PLN00129, succinate dehydrogenase [ubiqu 1e-106
PRK05950232 PRK05950, sdhB, succinate dehydrogenase iron-sulfu 1e-103
COG0479234 COG0479, FrdB, Succinate dehydrogenase/fumarate re 8e-73
TIGR00384220 TIGR00384, dhsB, succinate dehydrogenase and fumar 4e-66
PRK12575235 PRK12575, PRK12575, succinate dehydrogenase iron-s 3e-61
PLN00129276 PLN00129, PLN00129, succinate dehydrogenase [ubiqu 2e-51
PRK05950232 PRK05950, sdhB, succinate dehydrogenase iron-sulfu 5e-49
COG0479234 COG0479, FrdB, Succinate dehydrogenase/fumarate re 4e-39
TIGR00384220 TIGR00384, dhsB, succinate dehydrogenase and fumar 6e-35
pfam13085107 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster bind 5e-34
PRK12576279 PRK12576, PRK12576, succinate dehydrogenase iron-s 2e-30
PRK12577329 PRK12577, PRK12577, succinate dehydrogenase iron-s 8e-26
PRK12575235 PRK12575, PRK12575, succinate dehydrogenase iron-s 3e-21
PRK12576279 PRK12576, PRK12576, succinate dehydrogenase iron-s 2e-20
PRK12385244 PRK12385, PRK12385, fumarate reductase iron-sulfur 1e-18
PLN00129 276 PLN00129, PLN00129, succinate dehydrogenase [ubiqu 6e-18
PRK12577329 PRK12577, PRK12577, succinate dehydrogenase iron-s 2e-17
PRK06259 486 PRK06259, PRK06259, succinate dehydrogenase/fumara 6e-16
PRK12385244 PRK12385, PRK12385, fumarate reductase iron-sulfur 4e-15
PRK05950 232 PRK05950, sdhB, succinate dehydrogenase iron-sulfu 2e-14
PRK06259486 PRK06259, PRK06259, succinate dehydrogenase/fumara 4e-14
PRK13552239 PRK13552, frdB, fumarate reductase iron-sulfur sub 7e-14
PRK13552239 PRK13552, frdB, fumarate reductase iron-sulfur sub 1e-13
COG0479 234 COG0479, FrdB, Succinate dehydrogenase/fumarate re 2e-10
pfam1353461 pfam13534, Fer4_17, 4Fe-4S dicluster domain 2e-10
TIGR00384 220 TIGR00384, dhsB, succinate dehydrogenase and fumar 2e-09
PRK12386251 PRK12386, PRK12386, fumarate reductase iron-sulfur 3e-08
PRK08640249 PRK08640, sdhB, succinate dehydrogenase iron-sulfu 7e-06
pfam1318354 pfam13183, Fer4_8, 4Fe-4S dicluster domain 1e-05
COG0247 388 COG0247, GlpC, Fe-S oxidoreductase [Energy product 2e-05
pfam13085107 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster bind 3e-05
PRK12386251 PRK12386, PRK12386, fumarate reductase iron-sulfur 1e-04
PRK12575 235 PRK12575, PRK12575, succinate dehydrogenase iron-s 6e-04
pfam13085107 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster bind 7e-04
PRK12576 279 PRK12576, PRK12576, succinate dehydrogenase iron-s 7e-04
PRK08640249 PRK08640, sdhB, succinate dehydrogenase iron-sulfu 9e-04
PRK07570250 PRK07570, PRK07570, succinate dehydrogenase/fumara 0.001
>gnl|CDD|215067 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information 
 Score =  312 bits (801), Expect = e-106
 Identities = 124/247 (50%), Positives = 147/247 (59%), Gaps = 51/247 (20%)

Query: 107 SAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNN---------------- 150
           SA   ++    KP+  K F IYRWNPD P  KP +Q YKVDLN+                
Sbjct: 28  SAETKASSKGSKPSNLKEFQIYRWNPDNP-GKPHLQSYKVDLNDCGPMVLDVLIKIKNEQ 86

Query: 151 --------------------------------KIDAN-DKVSKIYPLPHMYVVKDLVPDM 177
                                           KID +    + I PLPHM+V+KDLV DM
Sbjct: 87  DPSLTFRRSCREGICGSCAMNIDGKNTLACLTKIDRDESGPTTITPLPHMFVIKDLVVDM 146

Query: 178 NNFYAQYKSIQPWLQR-DKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNG 236
            NFY QYKSI+PWL+       G  ++LQS +DR KLDG+YECILCACCSTSCPSYWWN 
Sbjct: 147 TNFYQQYKSIEPWLKTKKPPEDGQKEHLQSKEDRAKLDGMYECILCACCSTSCPSYWWNP 206

Query: 237 EKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAI 296
           EK+LGPA L+ AYRWI DSRDE T +RL  L D F +YRCHTI NC+  CPKGLNP +AI
Sbjct: 207 EKFLGPAALLHAYRWISDSRDEYTKERLEALDDEFKLYRCHTIRNCSNACPKGLNPAKAI 266

Query: 297 AEIKKLL 303
           A+IK+LL
Sbjct: 267 AKIKQLL 273

Length = 276
>gnl|CDD|235652 PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|223555 COG0479, FrdB, Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|232950 TIGR00384, dhsB, succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>gnl|CDD|171592 PRK12575, PRK12575, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|215067 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|235652 PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|223555 COG0479, FrdB, Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|232950 TIGR00384, dhsB, succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>gnl|CDD|221911 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|237143 PRK12576, PRK12576, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|183605 PRK12577, PRK12577, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|171592 PRK12575, PRK12575, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|237143 PRK12576, PRK12576, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|183490 PRK12385, PRK12385, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|215067 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|183605 PRK12577, PRK12577, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|235756 PRK06259, PRK06259, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|183490 PRK12385, PRK12385, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|235652 PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|235756 PRK06259, PRK06259, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|184136 PRK13552, frdB, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|184136 PRK13552, frdB, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|223555 COG0479, FrdB, Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|222205 pfam13534, Fer4_17, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|232950 TIGR00384, dhsB, succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>gnl|CDD|237086 PRK12386, PRK12386, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|181515 PRK08640, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|221963 pfam13183, Fer4_8, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|223325 COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|221911 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|237086 PRK12386, PRK12386, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|171592 PRK12575, PRK12575, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|221911 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|237143 PRK12576, PRK12576, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|181515 PRK08640, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181038 PRK07570, PRK07570, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 365
COG0479234 FrdB Succinate dehydrogenase/fumarate reductase, F 100.0
PRK13552239 frdB fumarate reductase iron-sulfur subunit; Provi 100.0
PLN00129276 succinate dehydrogenase [ubiquinone] iron-sulfur s 100.0
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
PRK08640249 sdhB succinate dehydrogenase iron-sulfur subunit; 100.0
PRK12386251 fumarate reductase iron-sulfur subunit; Provisiona 100.0
PRK12577329 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
PRK12385244 fumarate reductase iron-sulfur subunit; Provisiona 100.0
PRK05950232 sdhB succinate dehydrogenase iron-sulfur subunit; 100.0
PRK12576279 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
KOG3049|consensus288 100.0
TIGR00384220 dhsB succinate dehydrogenase and fumarate reductas 100.0
PRK07570250 succinate dehydrogenase/fumarate reductase iron-su 100.0
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 100.0
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 99.97
KOG3049|consensus 288 99.7
COG1150195 HdrC Heterodisulfide reductase, subunit C [Energy 99.53
TIGR03290144 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s 99.46
PRK08493 819 NADH dehydrogenase subunit G; Validated 99.42
PRK11274 407 glcF glycolate oxidase iron-sulfur subunit; Provis 99.42
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 99.39
TIGR00273432 iron-sulfur cluster-binding protein. Members of th 99.3
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 99.29
COG1139459 Uncharacterized conserved protein containing a fer 99.28
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 99.28
PRK07569234 bidirectional hydrogenase complex protein HoxU; Va 99.25
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 99.2
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 99.1
PTZ00305297 NADH:ubiquinone oxidoreductase; Provisional 99.1
PRK11168 396 glpC sn-glycerol-3-phosphate dehydrogenase subunit 99.09
PRK09129 776 NADH dehydrogenase subunit G; Validated 99.03
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 99.02
COG0247 388 GlpC Fe-S oxidoreductase [Energy production and co 99.02
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 99.01
PRK07860 797 NADH dehydrogenase subunit G; Validated 98.99
PRK09130 687 NADH dehydrogenase subunit G; Validated 98.98
TIGR03379 397 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase 98.95
PRK12385244 fumarate reductase iron-sulfur subunit; Provisiona 98.9
PRK08166 847 NADH dehydrogenase subunit G; Validated 98.87
PRK08640 249 sdhB succinate dehydrogenase iron-sulfur subunit; 98.87
PRK12575 235 succinate dehydrogenase iron-sulfur subunit; Provi 98.85
PF1353461 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 98.84
PF1318357 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ 98.84
PRK12577329 succinate dehydrogenase iron-sulfur subunit; Provi 98.71
PRK15055344 anaerobic sulfite reductase subunit A; Provisional 98.71
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 98.68
PRK05950232 sdhB succinate dehydrogenase iron-sulfur subunit; 98.67
TIGR00384220 dhsB succinate dehydrogenase and fumarate reductas 98.64
TIGR01945435 rnfC electron transport complex, RnfABCDGE type, C 98.62
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 98.53
TIGR02910334 sulfite_red_A sulfite reductase, subunit A. Member 98.52
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit 98.51
PRK05035 695 electron transport complex protein RnfC; Provision 98.42
TIGR01936447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 98.37
PRK00941 781 acetyl-CoA decarbonylase/synthase complex subunit 98.33
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 98.32
cd01916 731 ACS_1 Acetyl-CoA synthase (ACS), also known as ace 98.27
TIGR00314 784 cdhA CO dehydrogenase/acetyl-CoA synthase complex, 98.22
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 98.21
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 98.19
PRK12814 652 putative NADPH-dependent glutamate synthase small 98.14
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 98.1
PF1318755 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ 98.01
TIGR02484 372 CitB CitB domain protein. CobZ is essential for co 98.0
PF1374669 Fer4_18: 4Fe-4S dicluster domain 97.96
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 97.86
PF1283852 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 97.81
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 97.8
PRK15033 389 tricarballylate utilization protein B; Provisional 97.77
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 97.69
PRK13984 604 putative oxidoreductase; Provisional 97.64
COG1152 772 CdhA CO dehydrogenase/acetyl-CoA synthase alpha su 97.59
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino 97.53
PF1469759 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE 97.41
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 97.38
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 97.38
TIGR00403183 ndhI NADH-plastoquinone oxidoreductase subunit I p 97.33
PRK05888164 NADH dehydrogenase subunit I; Provisional 97.26
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 97.25
PRK14028312 pyruvate ferredoxin oxidoreductase subunit gamma/d 97.25
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 97.16
PRK0265181 photosystem I subunit VII; Provisional 97.14
CHL00014167 ndhI NADH dehydrogenase subunit I 97.13
TIGR01971122 NuoI NADH-quinone oxidoreductase, chain I. This mo 97.1
PF1348467 Fer4_16: 4Fe-4S double cluster binding domain 97.1
CHL0006581 psaC photosystem I subunit VII 97.07
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 97.06
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 97.05
PRK08348120 NADH-plastoquinone oxidoreductase subunit; Provisi 97.03
COG1453391 Predicted oxidoreductases of the aldo/keto reducta 97.03
CHL0013499 petF ferredoxin; Validated 97.02
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 97.0
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. 96.96
PRK08222181 hydrogenase 4 subunit H; Validated 96.96
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 96.91
PLN0007181 photosystem I subunit VII; Provisional 96.9
PRK06273165 ferredoxin; Provisional 96.87
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 96.86
KOG3256|consensus212 96.8
COG114599 NapF Ferredoxin [Energy production and conversion] 96.7
PRK09477271 napH quinol dehydrogenase membrane component; Prov 96.7
COG0633102 Fdx Ferredoxin [Energy production and conversion] 96.69
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subuni 96.68
TIGR0293691 fdxN_nitrog ferredoxin III, nif-specific. Members 96.67
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 96.63
PRK12387180 formate hydrogenlyase complex iron-sulfur subunit; 96.63
PRK09625133 porD pyruvate flavodoxin oxidoreductase subunit de 96.56
PRK09326 341 F420H2 dehydrogenase subunit F; Provisional 96.53
TIGR02163255 napH_ ferredoxin-type protein, NapH/MauN family. M 96.48
PRK06991270 ferredoxin; Provisional 96.47
TIGR02494 295 PFLE_PFLC glycyl-radical enzyme activating protein 96.46
PLN02593117 adrenodoxin-like ferredoxin protein 96.39
PRK05113191 electron transport complex protein RnfB; Provision 96.36
COG1149284 MinD superfamily P-loop ATPase containing an inser 96.34
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 96.33
TIGR01660 492 narH nitrate reductase, beta subunit. The Nitrate 96.33
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit del 96.28
PRK09800 956 putative hypoxanthine oxidase; Provisional 96.21
PRK10194163 ferredoxin-type protein; Provisional 96.2
TIGR00402101 napF ferredoxin-type protein NapF. The gene codes 96.18
TIGR02512 374 Fe_only_hydrog hydrogenases, Fe-only. This model d 96.17
PTZ00038191 ferredoxin; Provisional 96.16
PLN03136148 Ferredoxin; Provisional 96.16
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 96.1
PRK08764135 ferredoxin; Provisional 96.1
TIGR0217978 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta 96.08
COG114668 Ferredoxin [Energy production and conversion] 96.07
TIGR01944165 rnfB electron transport complex, RnfABCDGE type, B 96.06
COG2768354 Uncharacterized Fe-S center protein [General funct 96.02
PF1279722 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 95.99
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase s 95.84
TIGR02912314 sulfite_red_C sulfite reductase, subunit C. Member 95.69
PRK09898208 hypothetical protein; Provisional 95.67
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 95.65
PRK05713312 hypothetical protein; Provisional 95.6
PF1279815 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 95.56
TIGR00276282 iron-sulfur cluster binding protein, putative. Thi 95.55
TIGR02745434 ccoG_rdxA_fixG cytochrome c oxidase accessory prot 95.52
PRK07609339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 95.5
TIGR03224 411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p 95.39
PRK11872340 antC anthranilate dioxygenase reductase; Provision 95.34
PF1280017 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 95.31
PRK06259486 succinate dehydrogenase/fumarate reductase iron-su 95.29
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein 95.14
TIGR02700234 flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T 95.11
COG114491 Pyruvate:ferredoxin oxidoreductase and related 2-o 95.06
COG0437203 HybA Fe-S-cluster-containing hydrogenase component 95.05
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 95.05
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzy 95.05
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 94.96
TIGR02963467 xanthine_xdhA xanthine dehydrogenase, small subuni 94.92
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S 94.82
PRK13795636 hypothetical protein; Provisional 94.61
PF1280017 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 94.6
PRK10882328 hydrogenase 2 protein HybA; Provisional 94.58
TIGR02060132 aprB adenosine phosphosulphate reductase, beta sub 94.56
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 94.53
PRK10194163 ferredoxin-type protein; Provisional 94.52
TIGR02486314 RDH reductive dehalogenase. This model represents 94.51
PRK10882328 hydrogenase 2 protein HybA; Provisional 94.48
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzy 94.47
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 94.42
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 94.4
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 94.28
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S 94.28
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 94.27
PF1279815 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 94.21
TIGR01582283 FDH-beta formate dehydrogenase, beta subunit, Fe-S 94.17
PRK05464409 Na(+)-translocating NADH-quinone reductase subunit 94.05
PRK14993244 tetrathionate reductase subunit B; Provisional 94.05
TIGR03287391 methan_mark_16 putative methanogenesis marker 16 m 94.01
TIGR01941405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 93.95
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 93.83
TIGR01582283 FDH-beta formate dehydrogenase, beta subunit, Fe-S 93.66
PTZ00490143 Ferredoxin superfamily; Provisional 93.55
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein 93.5
PRK09476254 napG quinol dehydrogenase periplasmic component; P 93.37
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 93.33
TIGR01660 492 narH nitrate reductase, beta subunit. The Nitrate 93.21
PRK098531019 putative selenate reductase subunit YgfK; Provisio 93.2
PF1324798 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX 93.12
PRK07118280 ferredoxin; Validated 93.04
PRK09898208 hypothetical protein; Provisional 92.94
TIGR02951161 DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi 92.93
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 92.66
PRK07118280 ferredoxin; Validated 92.46
cd07030259 RNAP_D D subunit of Archaeal RNA polymerase. The D 92.28
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 92.28
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. Thi 92.18
PRK09476254 napG quinol dehydrogenase periplasmic component; P 92.08
PRK12771564 putative glutamate synthase (NADPH) small subunit; 91.94
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 91.92
PF1279722 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 91.9
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 91.8
PRK10330181 formate dehydrogenase-H ferredoxin subunit; Provis 91.77
PRK10330181 formate dehydrogenase-H ferredoxin subunit; Provis 91.65
TIGR02951161 DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi 91.57
COG1142165 HycB Fe-S-cluster-containing hydrogenase component 91.54
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 91.48
COG2878198 Predicted NADH:ubiquinone oxidoreductase, subunit 91.36
PF1374669 Fer4_18: 4Fe-4S dicluster domain 90.52
PRK00783263 DNA-directed RNA polymerase subunit D; Provisional 90.5
PLN02906 1319 xanthine dehydrogenase 90.47
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 90.37
PLN00192 1344 aldehyde oxidase 90.05
PRK13984 604 putative oxidoreductase; Provisional 89.96
PRK12387180 formate hydrogenlyase complex iron-sulfur subunit; 89.87
PRK14993244 tetrathionate reductase subunit B; Provisional 89.68
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 89.54
PF1318755 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ 89.51
COG2221317 DsrA Dissimilatory sulfite reductase (desulfovirid 89.29
PF1041840 DHODB_Fe-S_bind: Iron-sulfur cluster binding domai 89.26
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 89.06
PF1324798 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX 89.03
COG1150195 HdrC Heterodisulfide reductase, subunit C [Energy 88.39
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit 88.3
COG1941247 FrhG Coenzyme F420-reducing hydrogenase, gamma sub 88.28
TIGR02745 434 ccoG_rdxA_fixG cytochrome c oxidase accessory prot 88.23
TIGR02066341 dsrB sulfite reductase, dissimilatory-type beta su 87.65
COG1142165 HycB Fe-S-cluster-containing hydrogenase component 87.64
TIGR01936447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 87.54
COG1600337 Uncharacterized Fe-S protein [Energy production an 87.45
COG0437203 HybA Fe-S-cluster-containing hydrogenase component 87.28
PF1469759 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE 86.94
TIGR02163255 napH_ ferredoxin-type protein, NapH/MauN family. M 86.07
PRK08345289 cytochrome-c3 hydrogenase subunit gamma; Provision 86.02
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino 86.0
PF1283852 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 85.17
KOG3256|consensus212 84.62
PRK08222181 hydrogenase 4 subunit H; Validated 84.36
TIGR03290144 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s 84.28
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 83.64
PF1353461 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 83.6
PLN0007181 photosystem I subunit VII; Provisional 83.0
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Review 82.7
PF1318357 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ 82.47
PF1348467 Fer4_16: 4Fe-4S double cluster binding domain 82.23
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 82.23
PRK09477271 napH quinol dehydrogenase membrane component; Prov 82.21
COG3894 614 Uncharacterized metal-binding protein [General fun 80.95
PRK15055344 anaerobic sulfite reductase subunit A; Provisional 80.87
PRK0265181 photosystem I subunit VII; Provisional 80.56
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=6.8e-61  Score=446.81  Aligned_cols=200  Identities=56%  Similarity=1.015  Sum_probs=184.9

Q ss_pred             CHHHHHHHhhhccCCCcccccCCCCCCcCccEEEeCCcccccccccccccccccccccCCccccccccccchhhHHHHhh
Q psy5769           1 MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYK   80 (365)
Q Consensus         1 ~vl~al~~i~~~~d~~l~~~~~C~~~~CgsC~v~inG~~~laC~t~v~~~~~~~~~~p~~~~~~~~dl~~~~~~~~~~~~   80 (365)
                      ||||||++||+++||+|+||+|||+||||||+|+|||+|+|||+|.+.++.                             
T Consensus        31 ~vLdaL~~Ik~e~d~~Lsfr~sCR~gICGSCam~ING~prLAC~t~~~~~~-----------------------------   81 (234)
T COG0479          31 TVLDALLYIKEEQDPTLSFRRSCREGICGSCAMNINGKPRLACKTLMKDLE-----------------------------   81 (234)
T ss_pred             cHHHHHHHHHHhcCCccchhhhccCCcCCcceeEECCccccchhchhhhcc-----------------------------
Confidence            799999999999999999999999999999999999999999999998753                             


Q ss_pred             hhhhccCCCcccccccccchhhhhhhhhhhccCCCCCcccccchhhccccCCCCCCCCcchhhhhhhccccccCCCCcEE
Q psy5769          81 SIQRHLGGPWKILGTLTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNKIDANDKVSK  160 (365)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (365)
                                                                                                 .+.|+
T Consensus        82 ---------------------------------------------------------------------------~~~i~   86 (234)
T COG0479          82 ---------------------------------------------------------------------------EGVIT   86 (234)
T ss_pred             ---------------------------------------------------------------------------CCceE
Confidence                                                                                       23789


Q ss_pred             EeecCCCCccccccccchHHHHHHHhhCCccccCcCCCCcccccCCHHHHHhcccchhcccCCcccccCCCceeCCcccC
Q psy5769         161 IYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYL  240 (365)
Q Consensus       161 IePL~~fpVIkDLvVD~~~ff~klk~vkp~l~~~~~~~~~~~~~~~~e~~~~l~~~~~CI~CG~C~s~CP~~~~~~~~~l  240 (365)
                      ||||+|||||||||||+++||+++++++||++.+.+..... ++|+|+++++++++..||.||.|+++||++..++ +|+
T Consensus        87 iePL~~fpVIkDLVVD~~~f~~~~~~ikp~~~~~~~~~~~~-~~q~pe~~~~~~~~~~CI~Cg~C~s~CP~~~~~~-~f~  164 (234)
T COG0479          87 IEPLPNFPVIRDLVVDMEEFYEKLRKIKPYLIRDDEPDPGE-RLQSPEEREKLDELSECILCGCCTAACPSIWWNP-DFL  164 (234)
T ss_pred             EEECCCCCceeeeeeccHHHHHhhhccccceecCCcCCCcc-ccCCHHHHHHHHhhhhccccchhhhhCCcccccc-CCc
Confidence            99999999999999999999999999999999963332222 8999999999999999999999999999998765 899


Q ss_pred             CHHHHHHHHHHHhccCChhHHHHHhhhcCCCccccccccccccccCcCCCChHHHHHHHHHHHhcc
Q psy5769         241 GPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGL  306 (365)
Q Consensus       241 gP~~l~~~~r~~~d~rd~~~~erl~~~~~~~~l~~Ct~Cg~C~~vCP~gI~~~~~I~~lR~~l~~~  306 (365)
                      ||+++.+++|+++|+||....+|+..+...+++|+|++|++|++|||++|+++.+|..+|+++...
T Consensus       165 GPa~l~~a~R~~~D~rd~~~~~R~~~~~~~~gv~~C~~~~~C~~vCPK~i~p~~aI~~lk~~~~~~  230 (234)
T COG0479         165 GPAALRQAYRFLADSRDEGTAERLKILEDPDGVWRCTTCGNCTEVCPKGIPPAKAIAELKRRLAKR  230 (234)
T ss_pred             CHHHHHHHHHHhcCCcccchHHHHHhccCCCCEecccccccccccCCCCCCHHHHHHHHHHHHHHH
Confidence            999999999999999999989999988777899999999999999999999999999999987753

>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>KOG3049|consensus Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>KOG3049|consensus Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00273 iron-sulfur cluster-binding protein Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B Back     alignment and domain information
>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK15055 anaerobic sulfite reductase subunit A; Provisional Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR02910 sulfite_red_A sulfite reductase, subunit A Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA Back     alignment and domain information
>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J Back     alignment and domain information
>TIGR02484 CitB CitB domain protein Back     alignment and domain information
>PF13746 Fer4_18: 4Fe-4S dicluster domain Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>PRK15033 tricarballylate utilization protein B; Provisional Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion] Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein Back     alignment and domain information
>PRK05888 NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>CHL00014 ndhI NADH dehydrogenase subunit I Back     alignment and domain information
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I Back     alignment and domain information
>PF13484 Fer4_16: 4Fe-4S double cluster binding domain Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN00071 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK06273 ferredoxin; Provisional Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>KOG3256|consensus Back     alignment and domain information
>COG1145 NapF Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK09326 F420H2 dehydrogenase subunit F; Provisional Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family Back     alignment and domain information
>PRK06991 ferredoxin; Provisional Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family Back     alignment and domain information
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>PRK05113 electron transport complex protein RnfB; Provisional Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>TIGR01660 narH nitrate reductase, beta subunit Back     alignment and domain information
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>TIGR00402 napF ferredoxin-type protein NapF Back     alignment and domain information
>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>PRK08764 ferredoxin; Provisional Back     alignment and domain information
>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>COG1146 Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information
>COG2768 Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>TIGR02912 sulfite_red_C sulfite reductase, subunit C Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR00276 iron-sulfur cluster binding protein, putative Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein Back     alignment and domain information
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family Back     alignment and domain information
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>TIGR02486 RDH reductive dehalogenase Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>PRK14993 tetrathionate reductase subunit B; Provisional Back     alignment and domain information
>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing Back     alignment and domain information
>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>TIGR01660 narH nitrate reductase, beta subunit Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>cd07030 RNAP_D D subunit of Archaeal RNA polymerase Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional Back     alignment and domain information
>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional Back     alignment and domain information
>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>PF13746 Fer4_18: 4Fe-4S dicluster domain Back     alignment and domain information
>PRK00783 DNA-directed RNA polymerase subunit D; Provisional Back     alignment and domain information
>PLN02906 xanthine dehydrogenase Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK14993 tetrathionate reductase subunit B; Provisional Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J Back     alignment and domain information
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PF10418 DHODB_Fe-S_bind: Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B; InterPro: IPR019480 Lactococcus lactis is one of the few organisms with two dihydroorotate dehydrogenases (DHODs) A and B [] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG Back     alignment and domain information
>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>COG1600 Uncharacterized Fe-S protein [Energy production and conversion] Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>KOG3256|consensus Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B Back     alignment and domain information
>PLN00071 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N Back     alignment and domain information
>PF13484 Fer4_16: 4Fe-4S double cluster binding domain Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>PRK15055 anaerobic sulfite reductase subunit A; Provisional Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
1yq3_B252 Avian Respiratory Complex Ii With Oxaloacetate And 2e-78
1yq3_B 252 Avian Respiratory Complex Ii With Oxaloacetate And 1e-12
3abv_B252 Crystal Structure Of Porcine Heart Mitochondrial Co 4e-77
3abv_B 252 Crystal Structure Of Porcine Heart Mitochondrial Co 2e-14
1zoy_B252 Crystal Structure Of Mitochondrial Respiratory Comp 4e-77
1zoy_B 252 Crystal Structure Of Mitochondrial Respiratory Comp 2e-14
3vr8_B282 Mitochondrial Rhodoquinol-Fumarate Reductase From T 6e-69
3vr8_B 282 Mitochondrial Rhodoquinol-Fumarate Reductase From T 5e-13
1nek_B238 Complex Ii (Succinate Dehydrogenase) From E. Coli W 6e-50
1nek_B 238 Complex Ii (Succinate Dehydrogenase) From E. Coli W 1e-05
2wp9_B238 Crystal Structure Of The E. Coli Succinate:quinone 7e-49
2wp9_B 238 Crystal Structure Of The E. Coli Succinate:quinone 1e-05
1kf6_B243 E. Coli Quinol-Fumarate Reductase With Bound Inhibi 4e-16
2bs2_B241 Quinol:fumarate Reductase From Wolinella Succinogen 1e-12
1qlb_B239 Respiratory Complex Ii-Like Fumarate Reductase From 1e-12
>pdb|1YQ3|B Chain B, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 252 Back     alignment and structure 
Iteration: 1

 Score =  289 bits (739), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 145/255 (56%), Positives = 177/255 (69%), Gaps = 58/255 (22%)
Query: 105 QLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLN--------------N 150
           Q +AAA+S +        K F+IYRW+PDKP +KP MQ Y+VDLN              N
Sbjct: 2   QTAAAATSRI--------KKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKN 53
Query: 151 KIDAN-----------------------------------DKVSKIYPLPHMYVVKDLVP 175
           ++D+                                     K +KIYPLPHMYVVKDLVP
Sbjct: 54  ELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVP 113
Query: 176 DMNNFYAQYKSIQPWLQR-DKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWW 234
           D++NFYAQYKSI+P+L++ D+   G  QYLQS++DR+KLDGLYECILCACCSTSCPSYWW
Sbjct: 114 DLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWW 173
Query: 235 NGEKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGR 294
           NG+KYLGPAVLMQAYRW+IDSRD+ T +RL QL+DPFS+YRCHTIMNCTRTCPKGLNPG+
Sbjct: 174 NGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGK 233
Query: 295 AIAEIKKLLSGLVKK 309
           AIAEIKK+++   +K
Sbjct: 234 AIAEIKKMMATYKEK 248
>pdb|1YQ3|B Chain B, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 252 Back     alignment and structure
>pdb|3ABV|B Chain B, Crystal Structure Of Porcine Heart Mitochondrial Complex Ii Bound With N-Biphenyl-3-Yl-2-Trifluoromethyl-Benzamide Length = 252 Back     alignment and structure
>pdb|3ABV|B Chain B, Crystal Structure Of Porcine Heart Mitochondrial Complex Ii Bound With N-Biphenyl-3-Yl-2-Trifluoromethyl-Benzamide Length = 252 Back     alignment and structure
>pdb|1ZOY|B Chain B, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 252 Back     alignment and structure
>pdb|1ZOY|B Chain B, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 252 Back     alignment and structure
>pdb|3VR8|B Chain B, Mitochondrial Rhodoquinol-Fumarate Reductase From The Parasitic Nematode Ascaris Suum Length = 282 Back     alignment and structure
>pdb|3VR8|B Chain B, Mitochondrial Rhodoquinol-Fumarate Reductase From The Parasitic Nematode Ascaris Suum Length = 282 Back     alignment and structure
>pdb|1NEK|B Chain B, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 238 Back     alignment and structure
>pdb|1NEK|B Chain B, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 238 Back     alignment and structure
>pdb|2WP9|B Chain B, Crystal Structure Of The E. Coli Succinate:quinone Oxidoreductase (Sqr) Sdhb His207thr Mutant Length = 238 Back     alignment and structure
>pdb|2WP9|B Chain B, Crystal Structure Of The E. Coli Succinate:quinone Oxidoreductase (Sqr) Sdhb His207thr Mutant Length = 238 Back     alignment and structure
>pdb|1KF6|B Chain B, E. Coli Quinol-Fumarate Reductase With Bound Inhibitor Hqno Length = 243 Back     alignment and structure
>pdb|2BS2|B Chain B, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 241 Back     alignment and structure
>pdb|1QLB|B Chain B, Respiratory Complex Ii-Like Fumarate Reductase From Wolinella Succinogenes Length = 239 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 1e-101
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 4e-48
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 3e-15
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 2e-99
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 6e-49
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 1e-14
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 4e-99
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 2e-51
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 3e-16
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 6e-99
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 7e-46
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 5e-15
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 2e-93
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 2e-43
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 9e-13
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 4e-40
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 9e-21
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Length = 238 Back     alignment and structure
 Score =  299 bits (767), Expect = e-101
 Identities = 100/231 (43%), Positives = 133/231 (57%), Gaps = 52/231 (22%)

Query: 124 TFAIYRWNPDKPDEKPTMQEYKVDLN-----------NKIDAND---------------- 156
            F+IYR+NPD  D+ P MQ+Y ++ +            ++   D                
Sbjct: 4   EFSIYRYNPDV-DDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGS 62

Query: 157 ------------------------KVSKIYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQ 192
                                   K   I PLP + V++DLV DM  FYAQY+ I+P+L 
Sbjct: 63  DGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLL 122

Query: 193 RDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKYLGPAVLMQAYRWI 252
            + +N    ++LQ  + R+KLDGLYECILCACCSTSCPS+WWN +K++GPA L+ AYR++
Sbjct: 123 NNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFL 182

Query: 253 IDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLL 303
           IDSRD +T  RL+ L D FSV+RCH+IMNC   CPKGLNP RAI  IK +L
Sbjct: 183 IDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSML 233
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Length = 238 Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Length = 238 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Length = 241 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Length = 241 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Length = 241 Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Length = 243 Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Length = 243 Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Length = 243 Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Length = 282 Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Length = 282 Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Length = 282 Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Length = 252 Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Length = 252 Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Length = 252 Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Length = 514 Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Length = 514 Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Length = 514 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 100.0
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 100.0
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 100.0
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 100.0
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 100.0
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 100.0
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 99.7
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 99.62
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 99.48
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 99.28
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 99.27
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 99.25
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 99.22
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 98.76
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 98.71
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 98.59
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 98.38
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 98.36
2w3s_A462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 98.33
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 98.25
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 98.09
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 98.05
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 98.05
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 97.99
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 97.95
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 97.95
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron tr 97.92
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 97.89
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 97.83
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 97.78
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 97.68
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 97.64
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 97.48
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 97.44
1xer_A103 Ferredoxin; electron transport, iron-sulfur, dupli 97.3
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 97.3
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 97.29
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 97.28
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 97.18
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 97.14
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aro 97.05
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] clust 97.01
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; elec 96.99
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transpo 96.91
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 96.9
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 96.9
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; 96.85
1dwl_A59 Ferredoxin I; electron transfer, model, heteronucl 96.8
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 96.79
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 96.79
1hfe_L 421 Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg 96.79
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 96.78
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 96.76
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 96.73
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 96.62
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 96.51
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 96.43
1h98_A78 Ferredoxin; electron transport, thermophilic, iron 96.43
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 96.42
1dax_A64 Ferredoxin I; electron transport, electron-transfe 96.35
2v2k_A105 Ferredoxin; iron, transport, iron-sulfur, mycobact 96.34
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 96.32
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 96.18
1jnr_B150 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.14
3gyx_B166 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.04
1iqz_A81 Ferredoxin; iron-sulfer protein, ultlahigh resolut 96.0
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, 95.68
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molyb 95.12
2ivf_B352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 95.08
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 95.06
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membra 95.01
2ivf_B352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 94.93
1kqf_B294 FDH-N beta S, formate dehydrogenase, nitrate-induc 94.79
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 94.63
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 94.54
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 94.47
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 94.42
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 94.3
1kqf_B294 FDH-N beta S, formate dehydrogenase, nitrate-induc 93.36
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membra 93.34
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molyb 92.87
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 92.28
1h0h_B214 Formate dehydrogenase (small subunit); tungsten se 91.87
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 90.82
1h0h_B214 Formate dehydrogenase (small subunit); tungsten se 90.1
3mm5_B366 Sulfite reductase, dissimilatory-type subunit BET; 87.51
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 86.79
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] clust 83.74
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 83.63
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aro 83.36
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 83.06
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 82.2
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 81.86
2pa8_D265 DNA-directed RNA polymerase subunit D; ferredoxin- 81.64
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transpo 80.95
1xer_A103 Ferredoxin; electron transport, iron-sulfur, dupli 80.11
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
Probab=100.00  E-value=5.1e-54  Score=412.27  Aligned_cols=210  Identities=72%  Similarity=1.297  Sum_probs=189.5

Q ss_pred             CHHHHHHHhhhccCCCcccccCCCCCCcCccEEEeCCcccccccccccccccccccccCCccccccccccchhhHHHHhh
Q psy5769           1 MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDANDKVSKIYPLPHMYVVKDLVPDMNNFYAQYK   80 (365)
Q Consensus         1 ~vl~al~~i~~~~d~~l~~~~~C~~~~CgsC~v~inG~~~laC~t~v~~~~~~~~~~p~~~~~~~~dl~~~~~~~~~~~~   80 (365)
                      ||||||++|++++||+|+|+.+|+.|+||+|+|+|||++++||.|++.+..                             
T Consensus        67 tlLdaL~~i~~~~~ptl~~~~~C~~G~CGsC~V~InG~~~laC~t~v~~~~-----------------------------  117 (282)
T 3vr8_B           67 MVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNT-----------------------------  117 (282)
T ss_pred             cHHHHHHhcCcccCCceeecCCCCCCCCCCCEEEECCEEecchhhhHhHhc-----------------------------
Confidence            699999999988999999999999999999999999999999999996421                             


Q ss_pred             hhhhccCCCcccccccccchhhhhhhhhhhccCCCCCcccccchhhccccCCCCCCCCcchhhhhhhccccccCCCCcEE
Q psy5769          81 SIQRHLGGPWKILGTLTAKNIRSFQLSAAASSAVPAEKPAKYKTFAIYRWNPDKPDEKPTMQEYKVDLNNKIDANDKVSK  160 (365)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (365)
                                                                                                 ++.+|
T Consensus       118 ---------------------------------------------------------------------------~~~~t  122 (282)
T 3vr8_B          118 ---------------------------------------------------------------------------SKTTK  122 (282)
T ss_pred             ---------------------------------------------------------------------------CCcEE
Confidence                                                                                       35789


Q ss_pred             EeecCCCCccccccccchHHHHHHHhhCCccccCcCC-CCcccccCCHHHHHhcccchhcccCCcccccCCCceeCCccc
Q psy5769         161 IYPLPHMYVVKDLVPDMNNFYAQYKSIQPWLQRDKEN-IGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNGEKY  239 (365)
Q Consensus       161 IePL~~fpVIkDLvVD~~~ff~klk~vkp~l~~~~~~-~~~~~~~~~~e~~~~l~~~~~CI~CG~C~s~CP~~~~~~~~~  239 (365)
                      ||||+|||||||||||++.||+++++++||+..+.+. .+..+++|+++++++++++..||+||+|+++||++..++++|
T Consensus       123 IepL~~~pVikDLvvD~~~f~~~~~~v~p~l~~~~~~~~~~~~~~qs~~~~~~~~~~~~CI~CG~C~~aCP~~~~~~~~~  202 (282)
T 3vr8_B          123 IYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKY  202 (282)
T ss_pred             eccCCCCceeeccccccHHHHHHHHHHhhhcCCCCCCCCCchhcccCHHHHHHHHhhhhCcccCcCcccCCceeccCCcC
Confidence            9999999999999999999999999999999887643 456678999999999999999999999999999998777789


Q ss_pred             CCHHHHHHHHHHHhccCChhHHHHHhhhcCCCccccccccccccccCcCCCChHHHHHHHHHHHhcccccCCCCc
Q psy5769         240 LGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLSGLVKKDKPGL  314 (365)
Q Consensus       240 lgP~~l~~~~r~~~d~rd~~~~erl~~~~~~~~l~~Ct~Cg~C~~vCP~gI~~~~~I~~lR~~l~~~~~~~~P~~  314 (365)
                      +||+++++++|++.|+++....++++.+.+..++|.|++||+|+++||++|++.++|..+|+.++++..+..|+.
T Consensus       203 lGP~~li~a~r~~~d~rd~~~~erl~~l~~~~~l~~C~~Cg~C~~vCP~gI~~~~~I~~lR~~l~~~~~k~~~~~  277 (282)
T 3vr8_B          203 LGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLP  277 (282)
T ss_pred             CCHHHHHHHHHHHhCCcccchHHHHHHHhhcCCcccChhhCCccccCcCCCCHHHHHHHHHHHHHHhccCCCCcc
Confidence            999999999999999998766777776656679999999999999999999999999999999987655555544
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} Back     alignment and structure
>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Back     alignment and structure
>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A Back     alignment and structure
>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Back     alignment and structure
>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* Back     alignment and structure
>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Back     alignment and structure
>3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Back     alignment and structure
>2pa8_D DNA-directed RNA polymerase subunit D; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_D 3hkz_D 2waq_D 2wb1_D 2y0s_D Back     alignment and structure
>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 365
d1nekb1132 a.1.2.1 (B:107-238) Succinate dehydogenase {Escher 2e-40
d1nekb1 132 a.1.2.1 (B:107-238) Succinate dehydogenase {Escher 0.002
d1kf6b1138 a.1.2.1 (B:106-243) Fumarate reductase {Escherichi 2e-39
d1kf6b1 138 a.1.2.1 (B:106-243) Fumarate reductase {Escherichi 0.004
d2bs2b1133 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella 1e-35
d1kf6b2105 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur 8e-26
d1kf6b2105 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur 7e-09
d1kf6b2105 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur 1e-05
d2bs2b2106 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur 1e-24
d2bs2b2106 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur 5e-11
d2bs2b2106 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur 2e-05
d1nekb2106 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sul 9e-21
d1nekb2106 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sul 3e-09
d1nekb2106 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sul 1e-05
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure

class: All alpha proteins
fold: Globin-like
superfamily: alpha-helical ferredoxin
family: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain
domain: Succinate dehydogenase
species: Escherichia coli [TaxId: 562]

 Score =  137 bits (345), Expect = 2e-40
 Identities = 77/127 (60%), Positives = 98/127 (77%)

Query: 177 MNNFYAQYKSIQPWLQRDKENIGNAQYLQSLDDRKKLDGLYECILCACCSTSCPSYWWNG 236
           M  FYAQY+ I+P+L  + +N    ++LQ  + R+KLDGLYECILCACCSTSCPS+WWN 
Sbjct: 1   MGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNP 60

Query: 237 EKYLGPAVLMQAYRWIIDSRDEKTADRLNQLKDPFSVYRCHTIMNCTRTCPKGLNPGRAI 296
           +K++GPA L+ AYR++IDSRD +T  RL+ L D FSV+RCH+IMNC   CPKGLNP RAI
Sbjct: 61  DKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAI 120

Query: 297 AEIKKLL 303
             IK +L
Sbjct: 121 GHIKSML 127
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 133 Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 105 Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 105 Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 105 Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Length = 106 Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Length = 106 Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Length = 106 Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 99.96
d1nekb1132 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.96
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 99.95
d1kf6b1138 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.95
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 99.94
d2bs2b1133 Fumarate reductase {Wolinella succinogenes [TaxId: 99.91
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 99.1
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 99.06
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 98.61
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 98.4
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 98.38
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 98.19
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 98.14
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.09
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.09
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 98.01
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 98.01
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 98.01
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 97.85
d1jb0c_80 Photosystem I iron-sulfur protein PsaC {Synechococ 97.79
d1dura_55 Ferredoxin II {Peptostreptococcus asaccharolyticus 97.68
d1xera_103 Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} 97.67
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 97.67
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 97.67
d2fug91154 NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus 97.55
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 97.41
d2fug34151 NADH-quinone oxidoreductase chain 3, Nqo3, domain 97.39
d1rgva_80 Ferredoxin II {Thauera aromatica [TaxId: 59405]} 97.24
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 97.22
d1blua_80 Ferredoxin II {Chromatium vinosum [TaxId: 1049]} 97.2
d1gtea5173 Dihydropyrimidine dehydrogenase, C-terminal domain 97.13
d1bc6a_77 Ferredoxin {Bacillus schlegelii [TaxId: 1484]} 97.12
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 97.04
d1h98a_77 Ferredoxin {Thermus thermophilus [TaxId: 274]} 97.02
d7fd1a_106 Ferredoxin {Azotobacter vinelandii [TaxId: 354]} 96.92
d1vjwa_59 Ferredoxin A {Thermotoga maritima [TaxId: 2336]} 96.86
d1fxra_64 Ferredoxin I {Sulfate-reducing bacteria (Desulfovi 96.8
d1fxda_58 Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} 96.78
d1sj1a_66 Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI 96.78
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 96.44
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 96.37
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 96.34
d1jnrb_149 Adenylylsulfate reductase B subunit {Archaeon Arch 96.33
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 96.28
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 96.23
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 96.23
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 96.18
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 95.63
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 95.59
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 95.5
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 95.5
d3c7bb165 DsrB insert domain {Archaeoglobus fulgidus [TaxId: 95.48
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 95.46
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 95.21
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 95.12
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 95.02
d1kqfb1244 Formate dehydrogenase N, iron-sulfur (beta) subuni 95.02
d1iqza_81 Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 94.95
d1vlfn2195 Transhydroxylase beta subunit, BthL, N-terminal do 94.52
d1y5ib1 509 Respiratory nitrate reductase 1 beta chain {Escher 94.22
d1kqfb1244 Formate dehydrogenase N, iron-sulfur (beta) subuni 93.66
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 93.31
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 92.54
d2bs2b1133 Fumarate reductase {Wolinella succinogenes [TaxId: 91.67
d3c7bb165 DsrB insert domain {Archaeoglobus fulgidus [TaxId: 90.36
d1y5ib1 509 Respiratory nitrate reductase 1 beta chain {Escher 90.35
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 89.77
d1kf6b1138 Fumarate reductase {Escherichia coli [TaxId: 562]} 89.66
d1nekb1132 Succinate dehydogenase {Escherichia coli [TaxId: 5 89.2
d1h0hb_214 Tungsten containing formate dehydrogenase, small s 88.89
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 88.51
d1jb0c_80 Photosystem I iron-sulfur protein PsaC {Synechococ 88.29
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 87.93
d7fd1a_106 Ferredoxin {Azotobacter vinelandii [TaxId: 354]} 87.27
d1bc6a_77 Ferredoxin {Bacillus schlegelii [TaxId: 1484]} 86.96
d1blua_80 Ferredoxin II {Chromatium vinosum [TaxId: 1049]} 86.84
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 86.51
d2fug91154 NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus 86.28
d1h98a_77 Ferredoxin {Thermus thermophilus [TaxId: 274]} 86.26
d1rgva_80 Ferredoxin II {Thauera aromatica [TaxId: 59405]} 85.79
d1xera_103 Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} 85.71
d1dura_55 Ferredoxin II {Peptostreptococcus asaccharolyticus 85.24
d1gtea5173 Dihydropyrimidine dehydrogenase, C-terminal domain 81.53
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin domains from multidomain proteins
domain: Fumarate reductase iron-sulfur protein, N-terminal domain
species: Wolinella succinogenes [TaxId: 844]

Probab=99.96  E-value=1e-30  Score=214.16  Aligned_cols=50  Identities=40%  Similarity=0.729  Sum_probs=48.2

Q ss_pred             CHHHHHHHhhhccCCCcccccCCCCCCcCccEEEeCCccccccccccccc
Q psy5769           1 MVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGVNTLACISKIDAN   50 (365)
Q Consensus         1 ~vl~al~~i~~~~d~~l~~~~~C~~~~CgsC~v~inG~~~laC~t~v~~~   50 (365)
                      ||||||++|++++||||+||+|||+|+||||+|+|||+++|||.|++.++
T Consensus        35 tvld~L~~Ik~~~D~sl~fr~sCr~giCGsCam~ING~~~lAC~t~v~~~   84 (106)
T d2bs2b2          35 TIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDF   84 (106)
T ss_dssp             BHHHHHHHHHHHTCTTCCCCCSSSSSSSCTTEEEETTEEEEGGGCBGGGC
T ss_pred             cHHHHHHHHHHhcCCcEEEEeCcCCCCCCcceEEECCccccceeeeeecc
Confidence            69999999999999999999999999999999999999999999999764
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Back     information, alignment and structure
>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure