Diaphorina citri psyllid: psy5800

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--

VFSVVREQITRALSSQPASLDKFRANISRLTYSEITNLWQQERTSREEWESHAKPIVELKELITPEIVDLIQQQRLGYLVEGTRFTKYSSRGQVIILDKFWYVRLSPNHKVFQYGDCDEKSIPQLDHLPNKLPVADIKALLVGKDCPHMKEA

cHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEccccEEEEECcccccccccccccccccccccHHHHHccccccccccc

VFSVVREQITRALSSQPASLDKFRANISRLTYSEITNLWQ**********SHAKPIVELKELITPEIVDLIQQQRLGYLVEGTRFTKYSSRGQVIILDKFWYVRLSPNHKVFQYGDCDEKSIPQLDHLPNKLPVADIKALLVGKDCPH****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

VFSVVREQITRALSSQPASLDKFRANISRLTYSEITNLWQQERTSREEWESHAKPIVELKELITPEIVDLIQQQRLGYLVEGTRFTKYSSRGQVIILDKFWYVRLSPNHKVFQYGDCDEKSIPQLDHLPNKLPVADIKALLVGKDCPHMKEA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Engulfment and cell motility protein 1	Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in assocation with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1.	confident	Q92556
Engulfment and cell motility protein 1	Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in assocation with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1.	confident	Q8BPU7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006909 [BP]	phagocytosis	probable	GO:0006897, GO:0016192, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016477 [BP]	cell migration	probable	GO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0051716 [BP]	cellular response to stimulus	probable	GO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0050794 [BP]	regulation of cellular process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0030036 [BP]	actin cytoskeleton organization	probable	GO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0017124 [MF]	SH3 domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A98, chain B
Confidence level:very confident
Coverage over the Query: 53-151
View the alignment between query and template
View the model in PyMOL