Diaphorina citri psyllid: psy5809


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MSYHDSKASFVSDKSTYTNFSKNGNENSDFCIIFLFLDPYHASHCIGKCPVGEFLCIGSCVCIPQEWKCDGDLDCYAGEDEVKCVPEKECPAVRPVACPQSDSPKMCDKGFCPPLFKCLKKSWLCDGEDDCGDFSDEVNCVLARKFNDTKLSAEDFILVP
cccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccECccccccccccccccccccccccccccccccccccccccccccccccccccccccCCcccccccccccccccccccccccccccccccCCcccccccc
**************STYTNFSKNGNENSDFCIIFLFLDPYHASHCIGKCPVGEFLCIGSCVCIPQEWKCDGDLDCYAGEDEVKCVPEKECPAVRPVACPQSDSPKMCDKGFCPPLFKCLKKSWLCDGEDDCGDFSDEVNCVLARKFNDTKLSAEDFILVP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYHDSKASFVSDKSTYTNFSKNGNENSDFCIIFLFLDPYHASHCIGKCPVGEFLCIGSCVCIPQEWKCDGDLDCYAGEDEVKCVPEKECPAVRPVACPQSDSPKMCDKGFCPPLFKCLKKSWLCDGEDDCGDFSDEVNCVLARKFNDTKLSAEDFILVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030229 [MF]very-low-density lipoprotein particle receptor activityprobableGO:0038024, GO:0003674, GO:0030228, GO:0004872
GO:0071813 [MF]lipoprotein particle bindingprobableGO:0003674, GO:0071814, GO:0005488
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0005041 [MF]low-density lipoprotein receptor activityprobableGO:0038024, GO:0003674, GO:0030228, GO:0004872
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0030111 [BP]regulation of Wnt receptor signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0005901 [CC]caveolaprobableGO:0045121, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3M0C, chain C
Confidence level:very confident
Coverage over the Query: 103-137
View the alignment between query and template
View the model in PyMOL