Diaphorina citri psyllid: psy5810


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MPFCSQVENIVHTYHPDVFFIVYSDTNHTQRCLTSIPFCSTVENFVQTYHHVFFIVHSDTNHTQRCLTSMPFCSQVENFVQTYHPDVFFIVYSDTNHTQRCLTPMPFCSQVENFVQTYHPDVFVIVYSVIERKTFKKAEDMLKTLWDSKYIGEKAVILVANKADLERRRQVTHSDGKKLAYAWGVKFVETSVGLVYKTDELLVGIARQAGLNKKRNKLLAKKQKKMASYINNIKQFKWFSKVSCENLLVL
ccccccHHHHHHcccccEEEEEEcccccccccccccccccccccccccccEEEEEEECccccccccCEEECccccccccccccccccEEEEEEECcccCEEEEEEcccccHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccHHHHHHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccc
***CSQVENIVHTYHPDVFFIVYSDTNHTQRCLTSIPFCSTVENFVQTYHHVFFIVHSDTNHTQRCLTSMPFCSQVENFVQTYHPDVFFIVYSDTNHTQRCLTPMPFCSQVENFVQTYHPDVFVIVYSVIERKTFKKAEDMLKTLWDSKYIGEKAVILVANKADLERRRQVTHSDGKKLAYAWGVKFVETSVGLVYKTDELLVGIARQAGLNKKRNKL*****KKMASYINNIKQFKWFSKVSCENLLVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFCSQVENIVHTYHPDVFFIVYSDTNHTQRCLTSIPFCSTVENFVQTYHHVFFIVHSDTNHTQRCLTSMPFCSQVENFVQTYHPDVFFIVYSDTNHTQRCLTPMPFCSQVENFVQTYHPDVFVIVYSVIERKTFKKAEDMLKTLWDSKYIGEKAVILVANKADLERRRQVTHSDGKKLAYAWGVKFVETSVGLVYKTDELLVGIARQAGLNKKRNKLLAKKQKKMASYINNIKQFKWFSKVSCENLLVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0031954 [BP]positive regulation of protein autophosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0031952, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0001934, GO:0048522
GO:0055038 [CC]recycling endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0055037, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0032486 [BP]Rap protein signal transductionprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0007265, GO:0007264, GO:0035556, GO:0044699
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0019003 [MF]GDP bindingprobableGO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030139 [CC]endocytic vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0030336 [BP]negative regulation of cell migrationprobableGO:0040013, GO:0051270, GO:0065007, GO:0051271, GO:0040012, GO:0008150, GO:0030334, GO:2000145, GO:2000146, GO:0048519, GO:0032879, GO:0050794, GO:0050789, GO:0048523
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CBQ, chain A
Confidence level:very confident
Coverage over the Query: 50-108,119-213
View the alignment between query and template
View the model in PyMOL
Template: 1MKY, chain A
Confidence level:confident
Coverage over the Query: 53-74,88-238
View the alignment between query and template
View the model in PyMOL