Diaphorina citri psyllid: psy5811

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33

MKRNCFKNSALGGVVSISSSQCHRVVVDDKRVKKIKMKEEEEEKEEEEQEEEEEEEEEEEEQEEEFYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIENNISYLVLYPSLAPYTNGPPRGLSVEAKGPKDLPDTYLEQNIRHYPLANNEAESVYSINEAEPKVYSTRLFLLTILLRNVFSTNEKHYKSSCR

ccccccccccccccEEcccccCEEEEEEccccccccccccccccccccccccccccccccccccccEEEcccEEEEEEcccccEEEEEEcccEEEEEEEEEEEEEEccccccccccccccccEEEccccccccEEEEEcccccEEEccccEEccEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEcccEEEEEEEEcccEEHHHEEHHcccccccccccEEHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHccccEEEcccccccccCECccccccccEEccEEEEEEEEHHHHcccccccccccc

************GVVSISSSQCHRVVVDDKRVKKIKMKEEEEEKEEEEQEEEEEEEEEEEEQEEEFYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIENNISYLVLYPSLAPYTN******************TYLEQNIRHYPLANNEAESVYSINEAEPKVYSTRLFLLTILLRNVFSTN*********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKRNCFKNSALGGVVSISSSQCHRVVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIENNISYLVLYPSLAPYTNGPPRGLSVEAKGPKDLPDTYLEQNIRHYPLANNEAESVYSINEAEPKVYSTRLFLLTILLRNVFSTNEKHYKSSCR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0050896 [BP]	response to stimulus	probable	GO:0008150
GO:0004888 [MF]	transmembrane signaling receptor activity	probable	GO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0044700 [BP]	single organism signaling	probable	GO:0008150, GO:0023052, GO:0044699
GO:0005254 [MF]	chloride channel activity	probable	GO:0022891, GO:0022838, GO:0005215, GO:0008509, GO:0015108, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0015103, GO:0022892, GO:0022803, GO:0005253, GO:0005216
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0044459 [CC]	plasma membrane part	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0007154 [BP]	cell communication	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RHW, chain A
Confidence level:very confident
Coverage over the Query: 69-254
View the alignment between query and template
View the model in PyMOL