Psyllid ID: psy5811

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MKRNCFKNSALGGVVSISSSQCHRVVVDDKRVKKIKMKEEEEEKEEEEQEEEEEEEEEEEEQEEEFYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIENNISYLVLYPSLAPYTNGPPRGLSVEAKGPKDLPDTYLEQNIRHYPLANNEAESVYSINEAEPKVYSTRLFLLTILLRNVFSTNEKHYKSSCR
ccccccccccccccEEcccccEEEEEEEccccccccccccccccccccccccccccccccccccccEEEcccEEEEEEcccccEEEEEEcccEEEEEEEEEEEEEEccccccccccccccccEEEccccccccEEEEEcccccEEEccccEEccEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEcccEEEEEEEEcccEEHHHEEHHcccccccccccEEHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHccccEEEcccccccccEEEccccccccEEccEEEEEEEEHHHHcccccccccccc
cccccccccccccEEEEEcccccEEEEccccEEEEEEcEHHHHHHHHHHHHHcHHHHHHcccccEEEEcccccccEcccccccEEEEEccccEEEEEEEEEEEEccccccccccccccccEEEEEEcccccccEEEEEEccccEEEccccEccEEEEEEEEEEEEEEEEEccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHEccHHEEHHHHHHccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHccccccccHccccccEHHHHHHHHHHHHHHHHcccccccccccc
mkrncfknsalggvvsisssqchrvvvDDKRVKKIKMKEEEEEKEEEEQEEEEEEEEEEEEQEEEFYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLrkfpfdtqtcpllvgsfgytsndvkykwqsetpvdiEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQlkrntgffvlqtyvpcslmVCSSWvsfwidpdavparvsLDVDKQIKQWCRiennisylvlypslapytngpprglsveakgpkdlpdtyleqnirhyplanneaesvysineaepkvysTRLFLLTILLRNVFSTNEKHYKSSCR
mkrncfknsalggvvsisssqchrvvvddkRVKKikmkeeeeekeeeeqeeeeeeeeeeeeqeeefYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIENNISYLVLYPSLAPYTNGPPRGLSVEAKGPKDLPDTYLEQNIRHYPLANNEAESVYSINEAEPKVYSTRLFLLTILLRnvfstnekhyksscr
MKRNCFKNSALGGVVSISSSQCHrvvvddkrvkkikMkeeeeekeeeeqeeeeeeeeeeeeqeeeFYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIENNISYLVLYPSLAPYTNGPPRGLSVEAKGPKDLPDTYLEQNIRHYPLANNEAESVYSINEAEPKVYSTRLFLLTILLRNVFSTNEKHYKSSCR
***********************************************************************KCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIENNISYLVLYPSLAPYT*******************TYLEQNIRHYPLANNEAESVYSINEAEPKVYSTRLFLLTILLRNVFST**********
************GVVSISSSQCHRVVVDDKRVKKIKMKEEEEEKEEEEQEEEEEEEEEEEEQEEEFYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIENNISYLVLYPSLAPYTN******************TYLEQNIRHYP****************PKVYSTRLFLLTILLRNVFSTNEK*******
MKRNCFKNSALGGVVSISSSQCHRVVVDDKRVKKIKM*******************************KSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIENNISYLVLYPSLAPYTNGPPRGLSVEAKGPKDLPDTYLEQNIRHYPLANNEAESVYSINEAEPKVYSTRLFLLTILLRNVFSTN*********
****CF**S*LGGVVSISSSQCHRVVVDDKRVKKIKMKEEEEEKEEEEQEEEEEEEEEEEEQEEEFYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIENNISYLVLYPSLAPYTNGPPRGLSVEAKGPKDLPDTYLEQNIRHYPLANNEAESVYSINEAEPKVYSTRLFLLTILLRNVFSTN*********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRNCFKNSALGGVVSISSSQCHRVVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIENNISYLVLYPSLAPYTNGPPRGLSVEAKGPKDLPDTYLEQNIRHYPLANNEAESVYSINEAEPKVYSTRLFLLTILLRNVFSTNEKHYKSSCR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query329 2.2.26 [Sep-21-2011]
P24524464 Glycine receptor subunit yes N/A 0.401 0.284 0.424 6e-27
O75311464 Glycine receptor subunit yes N/A 0.401 0.284 0.424 7e-27
Q91XP5464 Glycine receptor subunit yes N/A 0.401 0.284 0.424 7e-27
Q7TNC8452 Glycine receptor subunit no N/A 0.398 0.289 0.419 9e-26
P23416452 Glycine receptor subunit no N/A 0.398 0.289 0.419 1e-25
P08220474 Gamma-aminobutyric acid r no N/A 0.425 0.295 0.373 4e-25
P50571474 Gamma-aminobutyric acid r no N/A 0.425 0.295 0.373 5e-25
P18505474 Gamma-aminobutyric acid r no N/A 0.425 0.295 0.373 5e-25
P15431474 Gamma-aminobutyric acid r no N/A 0.425 0.295 0.373 5e-25
P22771452 Glycine receptor subunit no N/A 0.398 0.289 0.412 1e-24
>sp|P24524|GLRA3_RAT Glycine receptor subunit alpha-3 OS=Rattus norvegicus GN=Glra3 PE=2 SV=1 Back     alignment and function desciption
 Score =  121 bits (304), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 81/132 (61%)

Query: 94  TLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELA 153
            L+  RLTLT +C M L+ FP D QTC + + SFGYT ND+ ++WQ E PV +  GL L 
Sbjct: 159 VLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLP 218

Query: 154 QYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWID 213
           Q+ L     ++           + I++ F L+R  G++++Q Y+P  L+V  SWVSFWI+
Sbjct: 219 QFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWIN 278

Query: 214 PDAVPARVSLDV 225
            DA PARV+L +
Sbjct: 279 MDAAPARVALGI 290
The glycine receptor is a neurotransmitter-gated ion channel. Binding of glycine to its receptor increases the chloride conductance and thus produces hyperpolarization (inhibition of neuronal firing).
Rattus norvegicus (taxid: 10116)
>sp|O75311|GLRA3_HUMAN Glycine receptor subunit alpha-3 OS=Homo sapiens GN=GLRA3 PE=2 SV=2 Back     alignment and function description
>sp|Q91XP5|GLRA3_MOUSE Glycine receptor subunit alpha-3 OS=Mus musculus GN=Glra3 PE=2 SV=2 Back     alignment and function description
>sp|Q7TNC8|GLRA2_MOUSE Glycine receptor subunit alpha-2 OS=Mus musculus GN=Glra2 PE=2 SV=1 Back     alignment and function description
>sp|P23416|GLRA2_HUMAN Glycine receptor subunit alpha-2 OS=Homo sapiens GN=GLRA2 PE=2 SV=1 Back     alignment and function description
>sp|P08220|GBRB1_BOVIN Gamma-aminobutyric acid receptor subunit beta-1 OS=Bos taurus GN=GABRB1 PE=2 SV=1 Back     alignment and function description
>sp|P50571|GBRB1_MOUSE Gamma-aminobutyric acid receptor subunit beta-1 OS=Mus musculus GN=Gabrb1 PE=1 SV=1 Back     alignment and function description
>sp|P18505|GBRB1_HUMAN Gamma-aminobutyric acid receptor subunit beta-1 OS=Homo sapiens GN=GABRB1 PE=2 SV=2 Back     alignment and function description
>sp|P15431|GBRB1_RAT Gamma-aminobutyric acid receptor subunit beta-1 OS=Rattus norvegicus GN=Gabrb1 PE=2 SV=1 Back     alignment and function description
>sp|P22771|GLRA2_RAT Glycine receptor subunit alpha-2 OS=Rattus norvegicus GN=Glra2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
242021132 570 gamma-aminobutyric-acid receptor alpha-2 0.437 0.252 0.493 7e-38
270006459 538 cys-loop ligand-gated ion channel subuni 0.395 0.241 0.442 2e-27
158262729 549 cys-loop ligand-gated ion channel subuni 0.395 0.236 0.442 3e-27
391345576 528 PREDICTED: gamma-aminobutyric acid recep 0.434 0.270 0.406 2e-26
308499242 491 CRE-LGC-37 protein [Caenorhabditis reman 0.382 0.256 0.449 3e-26
341899073 484 hypothetical protein CAEBREN_00525 [Caen 0.382 0.260 0.449 5e-26
321478277426 hypothetical protein DAPPUDRAFT_40350 [D 0.577 0.446 0.321 5e-26
71996779 483 Protein LGC-37 [Caenorhabditis elegans] 0.382 0.260 0.441 6e-26
405975540 431 Glycine receptor subunit alpha-2 [Crasso 0.489 0.373 0.378 7e-26
350423054 535 PREDICTED: gamma-aminobutyric acid recep 0.395 0.242 0.435 7e-26
>gi|242021132|ref|XP_002431000.1| gamma-aminobutyric-acid receptor alpha-2 subunit precursor, putative [Pediculus humanus corporis] gi|212516224|gb|EEB18262.1| gamma-aminobutyric-acid receptor alpha-2 subunit precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  164 bits (414), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 101/144 (70%)

Query: 82  PRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSE 141
           P   + L +     +  RLT++A+C M+LRKFP D Q CPL++GS+GYT  D+ YKW  E
Sbjct: 134 PNKFLRLRHDGFITYSMRLTISASCPMYLRKFPLDLQKCPLVLGSYGYTDKDLIYKWTDE 193

Query: 142 TPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSL 201
             + ++ G+E+AQ+ LVN+T  K+  +  G   +S I+ +F LKR+TG+F+LQ Y+PC L
Sbjct: 194 DAIGMQEGVEIAQFDLVNVTTQKSTTMVKGGLPYSTIKADFWLKRHTGYFMLQVYIPCGL 253

Query: 202 MVCSSWVSFWIDPDAVPARVSLDV 225
           +V  SW+SFWIDPDAVPARV+L V
Sbjct: 254 IVVCSWISFWIDPDAVPARVNLGV 277

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270006459|gb|EFA02907.1| cys-loop ligand-gated ion channel subunit [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158262729|ref|NP_001103425.1| cys-loop ligand-gated ion channel subunit precursor [Tribolium castaneum] gi|156447625|gb|ABU63605.1| cys-loop ligand-gated ion channel subunit [Tribolium castaneum] Back     alignment and taxonomy information
>gi|391345576|ref|XP_003747061.1| PREDICTED: gamma-aminobutyric acid receptor alpha-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|308499242|ref|XP_003111807.1| CRE-LGC-37 protein [Caenorhabditis remanei] gi|308239716|gb|EFO83668.1| CRE-LGC-37 protein [Caenorhabditis remanei] Back     alignment and taxonomy information
>gi|341899073|gb|EGT55008.1| hypothetical protein CAEBREN_00525 [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|321478277|gb|EFX89234.1| hypothetical protein DAPPUDRAFT_40350 [Daphnia pulex] Back     alignment and taxonomy information
>gi|71996779|ref|NP_499662.2| Protein LGC-37 [Caenorhabditis elegans] gi|30145743|emb|CAB07722.2| Protein LGC-37 [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|405975540|gb|EKC40099.1| Glycine receptor subunit alpha-2 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|350423054|ref|XP_003493370.1| PREDICTED: gamma-aminobutyric acid receptor alpha-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
WB|WBGene00013914483 lgc-37 [Caenorhabditis elegans 0.382 0.260 0.449 1.2e-27
UNIPROTKB|F1MNR0375 GLRA3 "Uncharacterized protein 0.398 0.349 0.427 7.3e-27
UNIPROTKB|F1Q2X8409 GLRA3 "Uncharacterized protein 0.398 0.320 0.427 7.3e-27
UNIPROTKB|F1RJ16376 GLRA3 "Uncharacterized protein 0.398 0.348 0.427 7.3e-27
UNIPROTKB|O00591440 GABRP "Gamma-aminobutyric acid 0.416 0.311 0.412 8.1e-27
UNIPROTKB|J9P291449 GLRA3 "Uncharacterized protein 0.398 0.291 0.427 8.6e-27
UNIPROTKB|E2R7P3464 GLRA3 "Uncharacterized protein 0.398 0.282 0.427 1.2e-26
UNIPROTKB|O75311464 GLRA3 "Glycine receptor subuni 0.398 0.282 0.427 1.2e-26
MGI|MGI:95749464 Glra3 "glycine receptor, alpha 0.398 0.282 0.427 1.2e-26
RGD|621229464 Glra3 "glycine receptor, alpha 0.398 0.282 0.427 1.2e-26
WB|WBGene00013914 lgc-37 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 312 (114.9 bits), Expect = 1.2e-27, P = 1.2e-27
 Identities = 58/129 (44%), Positives = 90/129 (69%)

Query:    99 RLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALV 158
             RLT+ + C+MFL+KFP DTQ CP+ VGS GY S DV YKW+ +  +D + G  L+QY ++
Sbjct:   165 RLTIRSRCQMFLKKFPMDTQACPIEVGSLGYFSKDVVYKWK-DVELDAKMGNTLSQYQVL 223

Query:   159 NMTAIKNKLVTIG-NDVH-SIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDA 216
             +++  +  +     +D + S++ + F+L+R  G+++LQ Y PC+L+V  SWVSFWI+ +A
Sbjct:   224 SLSKSERNVSDFRFSDRNISVLNVYFKLQRQQGYYILQIYTPCTLVVVMSWVSFWINKEA 283

Query:   217 VPARVSLDV 225
              PARVSL +
Sbjct:   284 SPARVSLGI 292
GO:0006811 "ion transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0005230 "extracellular ligand-gated ion channel activity" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0045211 "postsynaptic membrane" evidence=IEA
UNIPROTKB|F1MNR0 GLRA3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2X8 GLRA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJ16 GLRA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O00591 GABRP "Gamma-aminobutyric acid receptor subunit pi" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P291 GLRA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R7P3 GLRA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O75311 GLRA3 "Glycine receptor subunit alpha-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:95749 Glra3 "glycine receptor, alpha 3 subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621229 Glra3 "glycine receptor, alpha 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
TIGR00860459 TIGR00860, LIC, Cation transporter family protein 4e-34
pfam02931215 pfam02931, Neur_chan_LBD, Neurotransmitter-gated i 3e-18
pfam02932228 pfam02932, Neur_chan_memb, Neurotransmitter-gated 5e-09
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-08
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-08
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 8e-08
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 8e-08
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 9e-08
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 1e-06
pfam04712481 pfam04712, Radial_spoke, Radial spokehead-like pro 4e-05
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 5e-05
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 6e-05
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 7e-05
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 7e-05
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 7e-05
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 1e-04
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 1e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 1e-04
pfam09756189 pfam09756, DDRGK, DDRGK domain 1e-04
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 2e-04
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 2e-04
pfam0487497 pfam04874, Mak16, Mak16 protein C-terminal region 2e-04
COG2058109 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP 2e-04
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 3e-04
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 3e-04
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 3e-04
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 3e-04
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 3e-04
pfam00183 529 pfam00183, HSP90, Hsp90 protein 3e-04
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-04
TIGR03685105 TIGR03685, L12P_arch, 50S ribosomal protein L12P 4e-04
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 4e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 4e-04
pfam03344715 pfam03344, Daxx, Daxx Family 4e-04
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 4e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 5e-04
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 5e-04
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 5e-04
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 6e-04
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 6e-04
pfam1225376 pfam12253, CAF1A, Chromatin assembly factor 1 subu 6e-04
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 7e-04
COG2058109 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP 7e-04
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 7e-04
pfam05432291 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) 7e-04
PRK06402106 PRK06402, rpl12p, 50S ribosomal protein L12P; Revi 8e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 9e-04
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.001
pfam03066146 pfam03066, Nucleoplasmin, Nucleoplasmin 0.001
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 0.001
pfam03344715 pfam03344, Daxx, Daxx Family 0.001
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 0.001
pfam05432291 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 0.001
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 0.001
PRK14140191 PRK14140, PRK14140, heat shock protein GrpE; Provi 0.001
PRK14715 1627 PRK14715, PRK14715, DNA polymerase II large subuni 0.001
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 0.001
pfam08553 794 pfam08553, VID27, VID27 cytoplasmic protein 0.001
pfam10446 449 pfam10446, DUF2457, Protein of unknown function (D 0.001
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.002
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.002
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.002
COG2058109 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP 0.002
cd05832106 cd05832, Ribosomal_L12p, Ribosomal protein L12p 0.002
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 0.002
pfam03344715 pfam03344, Daxx, Daxx Family 0.002
pfam05432291 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) 0.002
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 0.002
pfam11861154 pfam11861, DUF3381, Domain of unknown function (DU 0.002
pfam03985431 pfam03985, Paf1, Paf1 0.002
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 0.002
pfam09747178 pfam09747, DUF2052, Coiled-coil domain containing 0.002
pfam1302570 pfam13025, DUF3886, Protein of unknown function (D 0.002
pfam04889241 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont 0.002
pfam0042888 pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro 0.002
pfam0042888 pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro 0.002
PRK14521186 PRK14521, rpsP, 30S ribosomal protein S16; Provisi 0.002
COG1614470 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas 0.002
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.003
pfam03247106 pfam03247, Prothymosin, Prothymosin/parathymosin f 0.003
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 0.003
pfam02459548 pfam02459, Adeno_terminal, Adenoviral DNA terminal 0.003
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.003
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 0.003
pfam03985431 pfam03985, Paf1, Paf1 0.003
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 0.003
pfam0303246 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/ 0.003
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.004
pfam05432291 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) 0.004
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.004
PRK04019330 PRK04019, rplP0, acidic ribosomal protein P0; Vali 0.004
>gnl|CDD|233155 TIGR00860, LIC, Cation transporter family protein Back     alignment and domain information 
 Score =  129 bits (327), Expect = 4e-34
 Identities = 49/129 (37%), Positives = 74/129 (57%), Gaps = 2/129 (1%)

Query: 99  RLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGL--ELAQYA 156
           R+TLT  C M LR FPFD Q C L   S+GYT+ND+K +W+ +  V ++  L   L ++ 
Sbjct: 149 RITLTLACPMDLRNFPFDVQNCSLKFESWGYTTNDIKLEWKEQGAVQVDDSLFISLPEFE 208

Query: 157 LVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDA 216
           L+ +   +          +  +  +F L+R   +++LQ Y+P  L+V  SWVSFW+  DA
Sbjct: 209 LLGVYGTRYCTSETNTGEYPCLTFSFVLRRRPLYYLLQLYIPSILIVILSWVSFWLPADA 268

Query: 217 VPARVSLDV 225
             ARVSL +
Sbjct: 269 SGARVSLGI 277

The Ligand-gated Ion Channel (LIC) Family of Neurotransmitter Receptors TC 1.A.9)Members of the LIC family of ionotropic neurotransmitter receptors are found only in vertebrate and invertebrate animals. They exhibit receptor specificity for (1)acetylcholine, (2) serotonin, (3) glycine, (4) glutamate and (5) g-aminobutyric acid (GABA). All of these receptor channels are probably hetero- orhomopentameric. The best characterized are the nicotinic acetyl-choline receptors which are pentameric channels of a2bgd subunit composition. All subunits arehomologous. The three dimensional structures of the protein complex in both the open and closed configurations have been solved at 0.9 nm resolution.The channel protein complexes of the LIC family preferentially transport cations or anions depending on the channel (e.g., the acetylcholine receptors are cationselective while glycine receptors are anion selective) [Transport and binding proteins, Cations and iron carrying compounds]. Length = 459
>gnl|CDD|217293 pfam02931, Neur_chan_LBD, Neurotransmitter-gated ion-channel ligand binding domain Back     alignment and domain information
>gnl|CDD|202474 pfam02932, Neur_chan_memb, Neurotransmitter-gated ion-channel transmembrane region Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|218303 pfam04874, Mak16, Mak16 protein C-terminal region Back     alignment and domain information
>gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) Back     alignment and domain information
>gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional Back     alignment and domain information
>gnl|CDD|237799 PRK14715, PRK14715, DNA polymerase II large subunit; Provisional Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|224969 COG2058, RPP1A, Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100110 cd05832, Ribosomal_L12p, Ribosomal protein L12p Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|220377 pfam09747, DUF2052, Coiled-coil domain containing protein (DUF2052) Back     alignment and domain information
>gnl|CDD|205206 pfam13025, DUF3886, Protein of unknown function (DUF3886) Back     alignment and domain information
>gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein Back     alignment and domain information
>gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein Back     alignment and domain information
>gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein Back     alignment and domain information
>gnl|CDD|237744 PRK14521, rpsP, 30S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|217450 pfam03247, Prothymosin, Prothymosin/parathymosin family Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information
>gnl|CDD|217829 pfam03985, Paf1, Paf1 Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|111875 pfam03032, Brevenin, Brevenin/esculentin/gaegurin/rugosin family Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|114172 pfam05432, BSP_II, Bone sialoprotein II (BSP-II) Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 329
KOG3643|consensus459 100.0
KOG3644|consensus457 100.0
TIGR00860459 LIC Cation transporter family protein. selective w 100.0
KOG3642|consensus466 99.97
KOG3646|consensus 486 99.97
KOG3645|consensus449 99.97
PF02931217 Neur_chan_LBD: Neurotransmitter-gated ion-channel 99.74
PF02932 237 Neur_chan_memb: Neurotransmitter-gated ion-channel 98.56
TIGR009271096 2A1904 K+-dependent Na+/Ca+ exchanger. 93.06
TIGR009271096 2A1904 K+-dependent Na+/Ca+ exchanger. 92.11
PF03066149 Nucleoplasmin: Nucleoplasmin; InterPro: IPR004301 91.81
PF10446458 DUF2457: Protein of unknown function (DUF2457); In 86.48
PF10446 458 DUF2457: Protein of unknown function (DUF2457); In 84.98
>KOG3643|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.3e-38  Score=305.76  Aligned_cols=186  Identities=33%  Similarity=0.658  Sum_probs=177.1

Q ss_pred             eeeecCccccccccccCCCceEEEeeCCeEEEEeccccccccccccCCCCcceeeEeeeeecccccccceEeeecC-CCc
Q psy5811          65 EFYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQS-ETP  143 (329)
Q Consensus        65 E~~t~s~~s~~~~~~~~~~~~v~V~~dG~V~~~~r~~~~~~C~mdl~~FPFD~Q~C~L~f~S~~y~~~ev~l~~~~-~~~  143 (329)
                      .|+.|+||+..|..+ ..|..++|++||+|+|+.|++.++.|+|||++||+|+|+|+|.+.||+|+.++|.+.|.. ++.
T Consensus       120 Tff~N~KkSf~H~~T-~~N~~lRl~~dGtVlys~RlT~Ta~C~MDL~~fPmD~Q~C~LeiESYGYt~~DI~y~W~~g~~a  198 (459)
T KOG3643|consen  120 TFFPNSKKSFFHDVT-THNSLLRLHPDGTVLYSIRLTVTAACPMDLKLFPMDSQNCKLEIESYGYTTDDIEYYWSKGDNA  198 (459)
T ss_pred             eecccCcccccceee-ecceEEEEcCCCeEEEEEEEEEEEecccccccCCCcccceeEEEEecccccccEEEEEcCCCcc
Confidence            899999999998886 899999999999999999999999999999999999999999999999999999999987 457


Q ss_pred             eeecccccccceeeeeeEEEEeEEeeecCCceeeEEEEEEEEeccceeeEeecchhHHHHhhhheeeeccCCCCCCeEEE
Q psy5811         144 VDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSL  223 (329)
Q Consensus       144 v~~~~~~~~~eW~l~~~~~~~~~~~~~~~g~ys~l~~~~~LkR~~~~yi~~iilP~~llvlLs~lsFwlp~~s~geRisl  223 (329)
                      +.......++++.+.+.........+ .+|.|+++.+.|.|+|+.+||++++++|+++++++||++|||..+++++|+++
T Consensus       199 v~~~e~i~LpqFti~~~~~~s~~~~~-sTG~Y~RL~l~F~l~Rnigf~ilQ~y~PS~LiVilSWVSFWin~~a~pARv~l  277 (459)
T KOG3643|consen  199 VKGDEKIELPQFTITEYHVTSRLVSF-STGNYSRLSLSFQLRRNIGFYILQTYIPSTLIVILSWVSFWINRDASPARVAL  277 (459)
T ss_pred             ccceeeeeccceEEEEEEEEEEEEEE-ccccceeEEEEEEEEeeccEEEEeeecchhhhhHHhHhHhhhccccchhheee
Confidence            77777899999999999999998888 79999999999999999999999999999999999999999999999999999


Q ss_pred             EEeeehhhhhhcccc------------------eEEEEeecCcCCCC
Q psy5811         224 DVDKQIKQWCRIENN------------------ISYLVLYPSLAPYT  252 (329)
Q Consensus       224 giT~LLs~t~~~~~~------------------v~~l~v~~~llp~t  252 (329)
                      |||++|+||+++.+.                  +||++||+++++.+
T Consensus       278 GITTVLTMTTl~t~~n~slPrvSYVKAiDiYL~vCFvfVF~sLLEYA  324 (459)
T KOG3643|consen  278 GITTVLTMTTLMTSTNESLPRVSYVKAIDVYLGVCFVFVFLSLLEYA  324 (459)
T ss_pred             ceehHHhHHHHHhhhhccCCCccceeeehhhhhHHHHHHHHHHHHHH
Confidence            999999999998652                  69999999999998

>KOG3644|consensus Back     alignment and domain information
>TIGR00860 LIC Cation transporter family protein Back     alignment and domain information
>KOG3642|consensus Back     alignment and domain information
>KOG3646|consensus Back     alignment and domain information
>KOG3645|consensus Back     alignment and domain information
>PF02931 Neur_chan_LBD: Neurotransmitter-gated ion-channel ligand binding domain ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature; InterPro: IPR006202 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ] Back     alignment and domain information
>PF02932 Neur_chan_memb: Neurotransmitter-gated ion-channel transmembrane region ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature; InterPro: IPR006029 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ] Back     alignment and domain information
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>PF03066 Nucleoplasmin: Nucleoplasmin; InterPro: IPR004301 The nucleophosmin/nucleoplasmin family of chaperones includes nucleophosmin, nucleoplasmin and nucleoplasmin-like proteins Back     alignment and domain information
>PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins Back     alignment and domain information
>PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
3rhw_A347 C. Elegans Glutamate-Gated Chloride Channel (Glucl) 2e-23
2bg9_E370 Refined Structure Of The Nicotinic Acetylcholine Re 1e-04
2bg9_B370 Refined Structure Of The Nicotinic Acetylcholine Re 2e-04
>pdb|3RHW|A Chain A, C. Elegans Glutamate-Gated Chloride Channel (Glucl) In Complex With Fab And Ivermectin Length = 347 Back     alignment and structure 
Iteration: 1

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 84/146 (57%), Gaps = 3/146 (2%)
Query: 82  PRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSE 141
           P   I + N    L+  R++L  +C M+L+ +P D Q C + + S+ YT+ D++Y W+  
Sbjct: 106 PNVLIRIHNDGTVLYSVRISLVLSCPMYLQYYPMDVQQCSIDLASYAYTTKDIEYLWKEH 165
Query: 142 TPVDIEHGLE--LAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPC 199
           +P+ ++ GL   L  + L N +      VT    ++S ++   QLKR   F++LQ Y+P 
Sbjct: 166 SPLQLKVGLSSSLPSFQLTNTSTTYCTSVT-NTGIYSCLRTTIQLKREFSFYLLQLYIPS 224
Query: 200 SLMVCSSWVSFWIDPDAVPARVSLDV 225
            ++V  SWVSFW D  A+PARV+L V
Sbjct: 225 CMLVIVSWVSFWFDRTAIPARVTLGV 250
>pdb|2BG9|E Chain E, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 370 Back     alignment and structure
>pdb|2BG9|B Chain B, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 370 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
3rhw_A347 Avermectin-sensitive glutamate-gated chloride CHA 100.0
4aq5_A461 Acetylcholine receptor subunit alpha; membrane pro 100.0
3tlw_A321 GLR4197 protein, GLIC; Cys-loop receptor family, m 100.0
2bg9_A370 Acetylcholine receptor protein, alpha chain; ION c 100.0
2bg9_E370 Acetylcholine receptor protein, gamma chain; ION c 99.98
2bg9_B370 Acetylcholine receptor protein, beta chain; ION ch 99.98
4aq5_C 522 Acetylcholine receptor delta subunit; membrane pro 99.97
4aq5_B 493 Acetylcholine receptor beta subunit; membrane prot 99.97
2bg9_C369 Acetylcholine receptor protein, delta chain; ION c 99.97
4aq5_E 488 Acetylcholine receptor gamma subunit; membrane pro 99.97
3rqw_A322 ELIC pentameric ligand gated ION channel from ERW 99.97
2qc1_B212 Acetylcholine receptor subunit alpha; nicotinic ac 99.88
3igq_A201 GLR4197 protein; plgic Cys-loop, membrane protein, 99.87
4aod_A205 Acetylcholine-binding protein type 1; ligand gated 99.84
4aoe_A205 Acetylcholine-binding protein type 2; ligand gated 99.84
2wn9_A228 Soluble acetylcholine receptor; 4-0H-DMXBA, acetyl 99.83
3sq6_A204 ACHBP, neuronal acetylcholine receptor subunit alp 99.83
1uw6_A211 Acetylcholine-binding protein; pentamer, IGG fold, 99.82
4afh_A230 ACHBP; acetylcholine-binding protein, nicotinic re 99.81
2bj0_A203 Acetylcholine-binding protein; 3D-structure, glyco 99.8
2ksr_A164 Neuronal acetylcholine receptor subunit beta-2; ni 99.4
2lkg_A140 Acetylcholine receptor; transmembrane domain, SIGN 99.35
2lly_A137 Neuronal acetylcholine receptor subunit alpha-4; t 99.17
1oed_E 260 Acetylcholine receptor protein, gamma chain; ION c 98.75
1oed_A227 Acetylcholine receptor protein, alpha chain; ION c 98.72
1oed_C 260 Acetylcholine receptor protein, delta chain; ION c 98.71
1oed_B 250 Acetylcholine receptor protein, beta chain; ION ch 98.71
1vry_A76 Glycine receptor alpha-1 chain; second transmembra 89.05
>3rhw_A Avermectin-sensitive glutamate-gated chloride CHA alpha; membrane protein, transport protein, Cys-loop receptor, LIGA ION channel, neurotransmitter receptor; HET: NAG IVM LMT UND; 3.26A {Caenorhabditis elegans} PDB: 3ri5_A* 3ria_A* 3rif_A* Back     alignment and structure
Probab=100.00  E-value=2.3e-35  Score=283.92  Aligned_cols=177  Identities=29%  Similarity=0.587  Sum_probs=154.4

Q ss_pred             cCccccccccccCCCceEEEeeCCeEEEEeccccccccccccCCCCcceeeEeeeeecccccccceEeeecCCCceeecc
Q psy5811          69 KSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEH  148 (329)
Q Consensus        69 ~s~~s~~~~~~~~~~~~v~V~~dG~V~~~~r~~~~~~C~mdl~~FPFD~Q~C~L~f~S~~y~~~ev~l~~~~~~~v~~~~  148 (329)
                      |++++..+.. ..++..++|++||+|.|.+|+++++.|+||+++||||+|+|+|+|+||+|+.+++.+.|....++...+
T Consensus        94 N~~~~~~~~~-~~~n~~v~i~~~G~V~~~~~~~~~s~C~~dl~~FPfD~Q~C~l~f~S~~y~~~~v~l~~~~~~~~~~~~  172 (347)
T 3rhw_A           94 NEKQAYKHTI-DKPNVLIRIHNDGTVLYSVRISLVLSCPMYLQYYPMDVQQCSIDLASYAYTTKDIEYLWKEHSPLQLKV  172 (347)
T ss_dssp             TEEEEEECCS-SSCSEEEEEETTSEEEEEEEEEEEEECCCCCTTGGGCEEEEEEEEEESSCCTTTEEEEECSSCSEEECT
T ss_pred             cccccccccc-ccccEEEEEeCCCCEEEecceEEEEEeeeeeccCCCcceeEEEEeccCcCChhhEEEEecCCCceeecC
Confidence            4444443333 256778899999999999999999999999999999999999999999999999999998744555554


Q ss_pred             --cccccceeeeeeEEEEeEEeeecCCceeeEEEEEEEEeccceeeEeecchhHHHHhhhheeeeccCCCCCCeEEEEEe
Q psy5811         149 --GLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVD  226 (329)
Q Consensus       149 --~~~~~eW~l~~~~~~~~~~~~~~~g~ys~l~~~~~LkR~~~~yi~~iilP~~llvlLs~lsFwlp~~s~geRislgiT  226 (329)
                        ...+++|++.+.....+...+ .++.|+++.++|+++|+++||++++++||+++++++|++||+|+++.|+|+++|+|
T Consensus       173 ~~~~~~~e~~l~~~~~~~~~~~~-~~~~y~~l~~~~~l~R~~~~y~~~l~iP~~li~~ls~~sF~lp~~~~~~Rv~lgit  251 (347)
T 3rhw_A          173 GLSSSLPSFQLTNTSTTYCTSVT-NTGIYSCLRTTIQLKREFSFYLLQLYIPSCMLVIVSWVSFWFDRTAIPARVTLGVT  251 (347)
T ss_dssp             TSGGGCCSEEEEEEEEEECCEEC-SSCEECEEEEEEEEEECSHHHHHHTHHHHHHHHHHHHTTTTSCTTCHHHHHHHHHH
T ss_pred             cceeEccceEEeeEEeeEeeeee-cccceeEEEEEEEEEEEeeEEEEEeehhHHHHHHHhheEEeccCCCCcceEEEEee
Confidence              567899999999887766655 78899999999999999999999999999999999999999999987899999999


Q ss_pred             eehhhhhhcccceEEEEeecCcCCCCCC
Q psy5811         227 KQIKQWCRIENNISYLVLYPSLAPYTNG  254 (329)
Q Consensus       227 ~LLs~t~~~~~~v~~l~v~~~llp~ts~  254 (329)
                      +||+|       +++++++++.+|.+++
T Consensus       252 ~lLt~-------tv~~~~~~~~lP~~S~  272 (347)
T 3rhw_A          252 TLLTM-------TAQSAGINSQLPPVSY  272 (347)
T ss_dssp             HHHHH-------HHHHHHHHHTSCCCSS
T ss_pred             hHHHH-------HHHHHHHHhhCCCccc
Confidence            99999       4777777888887765
>4aq5_A Acetylcholine receptor subunit alpha; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_A Back     alignment and structure
>3tlw_A GLR4197 protein, GLIC; Cys-loop receptor family, membrane protein, transport protei; HET: LMT; 2.60A {Gloeobacter violaceus} PDB: 3uu4_A* 3uub_A* 3tlv_A* 3uu6_A* 3uu5_A* 3uu3_A* 3tlu_A* 3uu8_A* 3tls_A* 3tlt_A* 3p4w_A* 3p50_A* 3eam_A* 4f8h_A* 2xq4_A 2xq5_A 2xq6_A 2xq3_A 2xq8_A 2xqa_A ... Back     alignment and structure
>2bg9_A Acetylcholine receptor protein, alpha chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Back     alignment and structure
>2bg9_E Acetylcholine receptor protein, gamma chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Back     alignment and structure
>2bg9_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Back     alignment and structure
>4aq5_C Acetylcholine receptor delta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_C Back     alignment and structure
>4aq5_B Acetylcholine receptor beta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_B Back     alignment and structure
>2bg9_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Back     alignment and structure
>4aq5_E Acetylcholine receptor gamma subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_E Back     alignment and structure
>3rqw_A ELIC pentameric ligand gated ION channel from ERW chrysanthemi; membrane, transport protein; HET: ACH MES; 2.91A {Dickeya dadantii} PDB: 2yn6_A* 3rqu_A* 3uq4_A 3uq5_A 3uq7_A 2vl0_A 2yks_A 4a97_A* 4a96_A* 2yoe_A* 4a98_A* Back     alignment and structure
>2qc1_B Acetylcholine receptor subunit alpha; nicotinic acetylcholine receptor, glycosylated protein, beta sandwich, Cys-loop, buried hydrophilic residues; HET: NAG MAN; 1.94A {Mus musculus} PDB: 1l4w_B 1ljz_B Back     alignment and structure
>3igq_A GLR4197 protein; plgic Cys-loop, membrane protein, transport protein; 2.30A {Gloeobacter violaceus} Back     alignment and structure
>4aod_A Acetylcholine-binding protein type 1; ligand gated ION channel, LGI Cys-loop receptor, ACHBP, ACHR, acetylcholine receptor; 6.00A {Biomphalaria glabrata} Back     alignment and structure
>4aoe_A Acetylcholine-binding protein type 2; ligand gated ION channel, LGI Cys-loop receptor, ACHBP, ACHR, acetylcholin receptor; 5.80A {Biomphalaria glabrata} Back     alignment and structure
>2wn9_A Soluble acetylcholine receptor; 4-0H-DMXBA, acetylcholine binding protein; HET: ZY5 NAG BMA MAN; 1.75A {Aplysia californica} PDB: 2wnj_A* 2wzy_A* 2x00_A* 3peo_A* 2pgz_A* 2ph9_A* 4dbm_A* 3c84_A* 2byq_A* 2byr_A* 2bys_A* 2wnc_A* 2wnl_A* 3c79_A* 2byn_A* 3pmz_A* 2x00_D* 2xnv_A* 2xnt_A* 2xnu_A* ... Back     alignment and structure
>3sq6_A ACHBP, neuronal acetylcholine receptor subunit alpha-7, acetylcholine-binding protein; nicotinic receptor; HET: EPJ NAG; 2.80A {Homo sapiens} SCOP: b.96.1.1 PDB: 3sq9_A* Back     alignment and structure
>1uw6_A Acetylcholine-binding protein; pentamer, IGG fold, nicotine, glycoprotein; HET: NCT; 2.2A {Lymnaea stagnalis} SCOP: b.96.1.1 PDB: 1i9b_A* 1ux2_A* 3u8l_A* 1yi5_A 1uv6_A* 3u8k_A* 3u8j_B* 3u8m_A* 3u8n_A* 2zju_A* 2zjv_A* Back     alignment and structure
>4afh_A ACHBP; acetylcholine-binding protein, nicotinic receptor, ION chann; HET: NAG BMA MAN L0B; 1.88A {Capitella teleta} PDB: 4afg_A* 4b5d_A* Back     alignment and structure
>2bj0_A Acetylcholine-binding protein; 3D-structure, glycoprotein, glycprotein, IGG fold, immunoglobulin domain, pentamer, signal; HET: CXS; 2.0A {Bulinus truncatus} Back     alignment and structure
>2ksr_A Neuronal acetylcholine receptor subunit beta-2; nicotinic acetylcholine receptors, transmembrane domain, HFI junction, cell membrane; NMR {Homo sapiens} PDB: 2lm2_A Back     alignment and structure
>2lkg_A Acetylcholine receptor; transmembrane domain, SIGN protein; NMR {Torpedo marmorata} PDB: 2lkh_A Back     alignment and structure
>2lly_A Neuronal acetylcholine receptor subunit alpha-4; transmembrane domain, transport PROT; NMR {Homo sapiens} Back     alignment and structure
>1oed_E Acetylcholine receptor protein, gamma chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 Back     alignment and structure
>1oed_A Acetylcholine receptor protein, alpha chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 PDB: 1dxz_A 3mra_A 2k59_B Back     alignment and structure
>1oed_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 PDB: 1a11_A 1cek_A 1eq8_A Back     alignment and structure
>1oed_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 PDB: 2k58_B Back     alignment and structure
>1vry_A Glycine receptor alpha-1 chain; second transmembrane domain, third transmembrane domain, membrane protein; NMR {Homo sapiens} SCOP: j.35.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 329
d1oede_ 260 f.36.1.1 (E:) Acetylcholine receptor protein, gamm 8e-09
d1uw6a_208 b.96.1.1 (A:) Acetylcholine binding protein (ACHBP 1e-07
d1oedb_ 250 f.36.1.1 (B:) Acetylcholine receptor protein, beta 4e-07
d1oeda_227 f.36.1.1 (A:) Acetylcholine receptor protein, alph 4e-07
d1oedc_ 260 f.36.1.1 (C:) Acetylcholine receptor protein, delt 2e-06
d2glza1149 d.81.3.1 (A:3-151) FwdE-like protein DSY1837 (Dhaf 0.004
>d1oede_ f.36.1.1 (E:) Acetylcholine receptor protein, gamma chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 260 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Neurotransmitter-gated ion-channel transmembrane pore
superfamily: Neurotransmitter-gated ion-channel transmembrane pore
family: Neurotransmitter-gated ion-channel transmembrane pore
domain: Acetylcholine receptor protein, gamma chain
species: Marbled electric ray (Torpedo marmorata) [TaxId: 7788]

 Score = 53.3 bits (127), Expect = 8e-09
 Identities = 6/36 (16%), Positives = 17/36 (47%)

Query: 190 FFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDV 225
           F+++    PC L+     + +++   A   + +L +
Sbjct: 3   FYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSI 38
>d1uw6a_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} Length = 208 Back     information, alignment and structure
>d1oedb_ f.36.1.1 (B:) Acetylcholine receptor protein, beta chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 250 Back     information, alignment and structure
>d1oeda_ f.36.1.1 (A:) Acetylcholine receptor protein, alpha chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 227 Back     information, alignment and structure
>d1oedc_ f.36.1.1 (C:) Acetylcholine receptor protein, delta chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 260 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
d1uw6a_208 Acetylcholine binding protein (ACHBP) {Great pond 99.78
d1oedc_ 260 Acetylcholine receptor protein, delta chain {Marbl 99.06
d1oedb_ 250 Acetylcholine receptor protein, beta chain {Marble 99.03
d1oede_ 260 Acetylcholine receptor protein, gamma chain {Marbl 99.02
d1oeda_227 Acetylcholine receptor protein, alpha chain {Marbl 99.01
>d1uw6a_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} Back     information, alignment and structure
class: All beta proteins
fold: Nicotinic receptor ligand binding domain-like
superfamily: Nicotinic receptor ligand binding domain-like
family: Nicotinic receptor ligand binding domain-like
domain: Acetylcholine binding protein (ACHBP)
species: Great pond snail (Lymnaea stagnalis) [TaxId: 6523]

Probab=99.78  E-value=3.5e-19  Score=157.56  Aligned_cols=108  Identities=12%  Similarity=0.191  Sum_probs=95.6

Q ss_pred             CCCceEEEeeCCeEEEEeccccccccccccCCCCcceeeEeeeeecccccccceEeeecCCCceeecccccccceeeeee
Q psy5811          81 SPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNM  160 (329)
Q Consensus        81 ~~~~~v~V~~dG~V~~~~r~~~~~~C~mdl~~FPFD~Q~C~L~f~S~~y~~~ev~l~~~~~~~v~~~~~~~~~eW~l~~~  160 (329)
                      .....++|++||+|.|.+++++++.|+|++..|| |+|+|.|.|+||+|+..++.+.+..........+..++||++.++
T Consensus        99 ~~~~~~~v~~~G~V~~~~~~~~~~~C~~~~~~f~-d~Q~C~l~fgSw~y~~~~i~l~~~~~~~~~~~~~~~~~eW~l~~~  177 (208)
T d1uw6a_          99 LTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTE-SGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDV  177 (208)
T ss_dssp             CSCCEEEEETTSEEEECCEEEEEEECCCTTTTSS-SCEEEEEEEEESSCCTTTEEEEECCCSSCTTTTSCTTSSEEEEEE
T ss_pred             ccceEEEEEeCCcEEEEecEEEEEeccccccCCc-ceEEEEEEEeCceeccceEEEeeccCCCccccccccCCCEEEEEe
Confidence            4557899999999999999999999999998888 899999999999999999999987633444455678999999999


Q ss_pred             EEEEeEEeee-cCCceeeEEEEEEEEeccc
Q psy5811         161 TAIKNKLVTI-GNDVHSIIQINFQLKRNTG  189 (329)
Q Consensus       161 ~~~~~~~~~~-~~g~ys~l~~~~~LkR~~~  189 (329)
                      ++.+....|. |.+.|+.+.|+|+|+|++.
T Consensus       178 ~~~~~~~~y~cc~~~y~~i~~~i~lrRr~~  207 (208)
T d1uw6a_         178 TQKKNSVTYSCCPEAYEDVEVSLNFRKKGR  207 (208)
T ss_dssp             EEEEEEEECTTCSSEEEEEEEEEEEEECCC
T ss_pred             EEEEEEEEeCCCCCCcceEEEEEEEEECCC
Confidence            9998888887 6789999999999999974
>d1oedc_ f.36.1.1 (C:) Acetylcholine receptor protein, delta chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1oedb_ f.36.1.1 (B:) Acetylcholine receptor protein, beta chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1oede_ f.36.1.1 (E:) Acetylcholine receptor protein, gamma chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1oeda_ f.36.1.1 (A:) Acetylcholine receptor protein, alpha chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure