Diaphorina citri psyllid: psy581

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---

SVPSILVGVGLIVVVGFIISAIQESKSKKKDKASRSSKKELKTLVDPDVKVPLKLKEKIEINHDTRCFRFELPSAEHVLGLPIGQHLSLSATINDEFVARAYTPVTSDEHHGYMDLVVKVYFKNVHPKFPDGGKMSQFLENMKVGEPINVSGPRGRLAYLGNGEFHIRAVSKKDPPTNLKVTQLSMIAGGTGITPMLQLVRHITKDPTDNTKMSLIFANQSEKDILLREELEEAAAKNPDQFKLWYTVDRPEDGWKYSTGFVSAEMIAEHLFPPSPDNLVLMCGPPRKTVKNNLKPEDKKEMKTLFSEFNKMKIHEGPPPMINFACKPNLDKLGYSEKLRFSY

ccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccCEEEEEEEEEEEcccEEEEEEEccccccccccccccEEEEEEEEccEEEEEEEccccccccccEEEEEEEEEEccccccccccccHHHHHHccccccEEEEEccccCEEECcccEEEEccccccccccccECcEEEEEEcccccccHHHHHHHHHcccccccEEEEEEEcccccccccHHHHHHHHHHccccEEEEEEEccccccccccEEEccHHHHHHHccccccccEEEEEccccccccccccccccHHHHHHHHHcccccccccccccccccccccHHccccccccEECc

SVPSILVGVGLIVVVGFIISAIQ************************DVKVPLKLKEKIEINHDTRCFRFELPSAEHVLGLPIGQHLSLSATINDEFVARAYTPVTSDEHHGYMDLVVKVYFKNVHPKFPDGGKMSQFLENMKVGEPINVSGPRGRLAYLGNGEFHIRAVSKKDPPTNLKVTQLSMIAGGTGITPMLQLVRHITKDPTDNTKMSLIFANQSEKDILLREELEEAAAKNPDQFKLWYTVDRPEDGWKYSTGFVSAEMIAEHLFPPSPDNLVLMCGPPRKTVKNNLKPEDKKEMKTLFSEFNKMKIHEGPPPMINFACKPNLDKLGYSEKLRFSY

xxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NADH-cytochrome b5 reductase 1	NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.	very confident	Q3MHW9
NADH-cytochrome b5 reductase 2	NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis and drug metabolism.	very confident	Q5BJ68
NADH-cytochrome b5 reductase 2	NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction. Responsible for NADH-dependent lucigenin chemiluminescence in spermatozoa by reducing both lucigenin and 2-[4-iodophenyl]-3-[4-nitrophenyl]-5-[2,4-disulfophenyl]-2H tetrazolium monosodium salt (WST-1).	confident	Q3KNK3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016020 [CC]	membrane	confident	GO:0005575
GO:0005739 [CC]	mitochondrion	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0050660 [MF]	flavin adenine dinucleotide binding	confident	GO:0043168, GO:0050662, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0010883 [BP]	regulation of lipid storage	probable	GO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0071949 [MF]	FAD binding	probable	GO:0043168, GO:0050662, GO:0050660, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0043531 [MF]	ADP binding	probable	GO:0043168, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0016208 [MF]	AMP binding	probable	GO:0043168, GO:0043169, GO:0017076, GO:0030554, GO:0097159, GO:0003674, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005789 [CC]	endoplasmic reticulum membrane	probable	GO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0055114 [BP]	oxidation-reduction process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0004128 [MF]	cytochrome-b5 reductase activity, acting on NAD(P)H	probable	GO:0003824, GO:0016491, GO:0003674, GO:0016651, GO:0016653
GO:0005743 [CC]	mitochondrial inner membrane	probable	GO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0051287 [MF]	NAD binding	probable	GO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0019852 [BP]	L-ascorbic acid metabolic process	probable	GO:0044238, GO:0006767, GO:0006766, GO:0005975, GO:0006082, GO:0005996, GO:0009987, GO:0044710, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0044723, GO:0043436, GO:0044237
GO:0005833 [CC]	hemoglobin complex	probable	GO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0002121 [BP]	inter-male aggressive behavior	probable	GO:0050896, GO:0007610, GO:0008150, GO:0002118, GO:0051705, GO:0051704
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0006898 [BP]	receptor-mediated endocytosis	probable	GO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0005741 [CC]	mitochondrial outer membrane	probable	GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0006695 [BP]	cholesterol biosynthetic process	probable	GO:0044281, GO:0044283, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0008203, GO:0016126, GO:0016125, GO:0006629, GO:0046165, GO:0009058, GO:0008150, GO:0008152, GO:0008202, GO:0008610, GO:0044238, GO:0006066, GO:0006694, GO:1901617, GO:1901615
GO:0006911 [BP]	phagocytosis, engulfment	probable	GO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0032940 [BP]	secretion by cell	probable	GO:0046903, GO:0006810, GO:0009987, GO:0044765, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0008015 [BP]	blood circulation	probable	GO:0032501, GO:0044707, GO:0003013, GO:0008150, GO:0044699, GO:0003008
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0040007 [BP]	growth	probable	GO:0008150

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.6.-.-	Acting on NADH or NADPH.	probable
1.6.2.-	With a heme protein as acceptor.	probable
1.6.2.2	Cytochrome-b5 reductase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMK, chain A
Confidence level:very confident
Coverage over the Query: 39-285,319-343
View the alignment between query and template
View the model in PyMOL

Template: 2PIA, chain A
Confidence level:very confident
Coverage over the Query: 44-169,180-311
View the alignment between query and template
View the model in PyMOL