Diaphorina citri psyllid: psy5829


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MWCSCLSRSKFLSSLQNSKMAVMMLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLAVKFHGNIFVNLLGEWADVGGGGPARAYPIGGLCYYLSPPENLGHFLLLLLLRFVNKPLI
cHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHEEEEEEEEECccccCEEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEECcccccccccCCccEEEEEEcccccHHHHHHHHHHHHHccccc
*WCSCLSRSKFLSSLQNSKMAVMMLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLAVKFHGNIFVNLLGEWADVGGGGPARAYPIGGLCYYLSPPENLGHFLLLLLLRFVNKPLI
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWCSCLSRSKFLSSLQNSKMAVMMLATVLVFAIVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSNLYVISQMLAVKFHGNIFVNLLGEWADVGGGGPARAYPIGGLCYYLSPPENLGHFLLLLLLRFVNKPLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein transport protein Sec61 subunit alpha-like 1 Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins.confidentQ90ZM2
Protein transport protein Sec61 subunit alpha isoform 2 Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins.confidentQ2KHX4
Protein transport protein Sec61 subunit alpha-like 2 Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins.confidentQ90YL4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030176 [CC]integral to endoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0045169 [CC]fusomeprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005784 [CC]Sec61 translocon complexprobableGO:0005783, GO:0044464, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0005791, GO:0071256, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0030867, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0042335 [BP]cuticle developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005048 [MF]signal sequence bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0005488
GO:0008258 [BP]head involutionprobableGO:0048598, GO:0032502, GO:0001700, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0006616 [BP]SRP-dependent cotranslational protein targeting to membrane, translocationprobableGO:0008104, GO:0006613, GO:0006612, GO:0006614, GO:0051641, GO:0044699, GO:0070972, GO:0071806, GO:0070727, GO:0006886, GO:0051179, GO:0065002, GO:0071702, GO:0033036, GO:0006810, GO:0072599, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0055085, GO:0016482, GO:0046907, GO:0045047, GO:0015031, GO:0008150, GO:0009987
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010942 [BP]positive regulation of cell deathprobableGO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0010941, GO:0050789, GO:0048522
GO:0021986 [BP]habenula developmentprobableGO:0032502, GO:0021536, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0021538, GO:0044767, GO:0048513, GO:0030900, GO:0048731, GO:0008150, GO:0007275, GO:0044699, GO:0007417
GO:0008219 [BP]cell deathprobableGO:0010259, GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0002479 [BP]antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependentprobableGO:0002474, GO:0019882, GO:0019884, GO:0002478, GO:0002376, GO:0042590, GO:0008150, GO:0048002
GO:0010507 [BP]negative regulation of autophagyprobableGO:0009894, GO:0009895, GO:0009892, GO:0019222, GO:0031329, GO:0031330, GO:0031324, GO:0031323, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0010506, GO:0050789, GO:0048523
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0034341 [BP]response to interferon-gammaprobableGO:0002376, GO:0034097, GO:0050896, GO:0045087, GO:0006952, GO:0006950, GO:0008150, GO:0006955, GO:0042221, GO:0010033
GO:0007391 [BP]dorsal closureprobableGO:0048598, GO:0002009, GO:0001700, GO:0048856, GO:0044707, GO:0032501, GO:0060429, GO:0016331, GO:0009888, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0048729, GO:0009653, GO:0032502, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WWB, chain A
Confidence level:very confident
Coverage over the Query: 16-130
View the alignment between query and template
View the model in PyMOL