Diaphorina citri psyllid: psy5853


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------
MVLPPPIKPDISNVTGQGGGTAEYRRRTYEFVDNNRRDYRSGYSDSNSVQLSLAKIAIDRAVISRCYMYAMYPNGDGDISRDQVLHEHVKNLAKIITPNHKYLRIPKMFHSECPWPAAQAEISSISSYKTAHDKVQCVYRTLNTILNLLSLTSAVPAADDLIPVLVYVLIKANPPSLLSTVQYVNSFYANKMEGEIQYWWVQFCSAIEFIKTMDYKE
ccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccc
******I********************TYEFVDNNRRDYR*******SVQLSLAKIAIDRAVISRCYMYAMYPNGDGDISRDQVLHEHVKNLAKIITPNHKYLRIPKMFHSECPWPAAQAEISSISSYKTAHDKVQCVYRTLNTILNLLSLTSAVPAADDLIPVLVYVLIKANPPSLLSTVQYVNSFYANKMEGEIQYWWVQFCSAIEFIKTMDY**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLPPPIKPDISNVTGQGGGTAEYRRRTYEFVDNNRRDYRSGYSDSNSVQLSLAKIAIDRAVISRCYMYAMYPNGDGDISRDQVLHEHVKNLAKIITPNHKYLRIPKMFHSECPWPAAQAEISSISSYKTAHDKVQCVYRTLNTILNLLSLTSAVPAADDLIPVLVYVLIKANPPSLLSTVQYVNSFYANKMEGEIQYWWVQFCSAIEFIKTMDYKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GTPase-activating protein and VPS9 domain-containing protein 1 Acts both as a GTPase-activating protein (GAP) and a guanine nucleotide exchange factor (GEF), and participates in various processes such as endocytosis, insulin receptor internalization or LC2A4/GLUT4 trafficking. Acts as a GEF for the Ras-related protein RAB31 by exchanging bound GDP for free GTP, leading to regulate LC2A4/GLUT4 trafficking. In the absence of insulin, it maintains RAB31 in an active state and promotes a futile cycle between LC2A4/GLUT4 storage vesicles and early endosomes, retaining LC2A4/GLUT4 inside the cells. Upon insulin stimulation, it is translocated to the plasma membrane, releasing LC2A4/GLUT4 from intracellular storage vesicles. Also involved in EGFR trafficking and degradation, possibly by promoting EGFR ubiquitination and subsequent degradation by the proteasome. Has GEF activity for Rab5 and GAP activity for Ras.confidentA5D794
GTPase-activating protein and VPS9 domain-containing protein 1 Acts both as a GTPase-activating protein (GAP) and a guanine nucleotide exchange factor (GEF), and participates in various processes such as endocytosis, insulin receptor internalization or LC2A4/GLUT4 trafficking. Acts as a GEF for the Ras-related protein RAB31 by exchanging bound GDP for free GTP, leading to regulate LC2A4/GLUT4 trafficking. In the absence of insulin, it maintains RAB31 in an active state and promotes a futile cycle between LC2A4/GLUT4 storage vesicles and early endosomes, retaining LC2A4/GLUT4 inside the cells. Upon insulin stimulation, it is translocated to the plasma membrane, releasing LC2A4/GLUT4 from intracellular storage vesicles. Also involved in EGFR trafficking and degradation, possibly by promoting EGFR ubiquitination and subsequent degradation by the proteasome. Has GEF activity for Rab5 and GAP activity for Ras.confidentQ6PAR5
GTPase-activating protein and VPS9 domain-containing protein 1 Acts both as a GTPase-activating protein (GAP) and a guanine nucleotide exchange factor (GEF), and participates in various processes such as endocytosis, insulin receptor internalization or LC2A4/GLUT4 trafficking. Acts as a GEF for the Ras-related protein RAB31 by exchanging bound GDP for free GTP, leading to regulate LC2A4/GLUT4 trafficking. In the absence of insulin, it maintains RAB31 in an active state and promotes a futile cycle between LC2A4/GLUT4 storage vesicles and early endosomes, retaining LC2A4/GLUT4 inside the cells. Upon insulin stimulation, it is translocated to the plasma membrane, releasing LC2A4/GLUT4 from intracellular storage vesicles. Also involved in EGFR trafficking and degradation, possibly by promoting EGFR ubiquitination and subsequent degradation by the proteasome. Has GEF activity for Rab5 and GAP activity for Ras.confidentQ14C86

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OT3, chain A
Confidence level:very confident
Coverage over the Query: 7-216
View the alignment between query and template
View the model in PyMOL