Diaphorina citri psyllid: psy5865


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MNYTASSLNYSVERLKIRSVYNNIYRRKPAVPRTPLLPAEGAIFVTNYRIIFKGTPLDPFACEQVVTRAFPITSLNKEKKITSQYLSHLDQSLQEGYQLRSSTFQVTALTSMG
ccccccccccccEEEEEEEEEcccccccccccccccccccccEEEEEEEEEEECcccccccccCEEEcccccccccCCcEEcccccccccccccccEEEEEcEEEEEEEEccc
********NYSVERLKIRSVYNNIYRRKPAVPRTPLLPAEGAIFVTNYRIIFKGTPLDPFACEQVVTRAFPITSLNKEKKITSQYLSHLDQSLQEGYQLRSSTFQVTALTSM*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNYTASSLNYSVERLKIRSVYNNIYRRKPAVPRTPLLPAEGAIFVTNYRIIFKGTPLDPFACEQVVTRAFPITSLNKEKKITSQYLSHLDQSLQEGYQLRSSTFQVTALTSMG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Myotubularin-related protein 5 Probable pseudophosphatase. Lacks several amino acids in the catalytic pocket which renders it catalytically inactive as a phosphatase. The pocket is however sufficiently preserved to bind phosphorylated substrates, and maybe protect them from phosphatases. Inhibits myoblast differentiation in vitro and induces oncogenic transformation in fibroblasts.confidentO95248
Myotubularin-related protein 5 Probable pseudophosphatase. Lacks several amino acids in the catalytic pocket which renders it catalytically inactive as a phosphatase. The pocket is however sufficiently preserved to bind phosphorylated substrates, and maybe protect them from phosphatases. Inhibits myoblast differentiation in vitro and induces oncogenic transformation in fibroblasts.confidentQ6ZPE2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0055037 [CC]recycling endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0017112 [MF]Rab guanyl-nucleotide exchange factor activityprobableGO:0005088, GO:0005083, GO:0005085, GO:0030695, GO:0003674, GO:0060589, GO:0030234
GO:0016020 [CC]membraneprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZSQ, chain A
Confidence level:confident
Coverage over the Query: 10-112
View the alignment between query and template
View the model in PyMOL