Diaphorina citri psyllid: psy5867


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------
MSSKDIFEKDPVMEERLGRIREVGSQAIWSLSSCKPGFGVDQLRDDCMDTYWQSDGQLPHLVNVQFRRKTTVQDICIYRQLPHLVNVQFRRKTTVQDICIYTDYKLDESYTPSRVSVRAGTNFNDLQEIEVVDLNEPSGWVKIPIKDIHDKPIRTYMIQIAVMSNHQNGRDTHMRQIKVYSPVQQHPSTMFTTVECQQVSVRAGTNFNDLQEIEVVDLNEPSGWVKIPIKDIHDKPIRTYMIQIAVMSNHQNGRDTHMRQIKVYSPVQQHPSTMFTTVECQQYAVIR
cccccccccccccHHccccccccccccEEEEcccccccccccccccccccCEECcccccEEEEEEccccccccEEEEEcccccEEEEEEEcccEEEEEEEEEcccccccccccEEEEEEcccccccEEEEEEECcccccEEEEECcccccccEEEEEEEEEEEEEcccccccEEEEEEEEcccccccccccccCEEccEEccccccccccHHHEEEccccccccEEEEccccccccEEEEEEEEEEEEccccccccEEEEEEEEccccccccccccccEEEEEEEcc
*****************GRIREVGSQAIWSLSSCKPGFGVDQLRDDCMDTYWQSDGQLPHLVNVQFRRKTTVQDICIYRQLPHLVNVQFRRKTTVQDICIYTDYKLDESYTPSRVSVRAGTNFNDLQEIEVVDLNEPSGWVKIPIKDIHDKPIRTYMIQIAVMSNHQNGRDTHMRQIKVYSPVQQHPSTMFTTVECQQVSVRAGTNFNDLQEIEVVDLNEPSGWVKIPIKDIHDKPIRTYMIQIAVMSNHQNGRDTHMRQIKVYSPVQQHPSTMFTTVECQQYAVIR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSKDIFEKDPVMEERLGRIREVGSQAIWSLSSCKPGFGVDQLRDDCMDTYWQSDGQLPHLVNVQFRRKTTVQDICIYRQLPHLVNVQFRRKTTVQDICIYTDYKLDESYTPSRVSVRAGTNFNDLQEIEVVDLNEPSGWVKIPIKDIHDKPIRTYMIQIAVMSNHQNGRDTHMRQIKVYSPVQQHPSTMFTTVECQQVSVRAGTNFNDLQEIEVVDLNEPSGWVKIPIKDIHDKPIRTYMIQIAVMSNHQNGRDTHMRQIKVYSPVQQHPSTMFTTVECQQYAVIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Anaphase-promoting complex subunit 10 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.confidentQ9UM13
Anaphase-promoting complex subunit 10 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.confidentQ8K2H6
Anaphase-promoting complex subunit 10 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.confidentQ2YDH1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0070979 [BP]protein K11-linked ubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0000209

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JHJ, chain A
Confidence level:very confident
Coverage over the Query: 6-67,91-183
View the alignment between query and template
View the model in PyMOL
Template: 1JHJ, chain A
Confidence level:very confident
Coverage over the Query: 130-267
View the alignment between query and template
View the model in PyMOL