Diaphorina citri psyllid: psy5891

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26

MSKIKAEDLFVPTARRHKITSALAGLNSKEEEEEEQEDSAFSDESADDNSSDEDETVEPKVFYAEVTKKLKLTGVPMKIYKKTAFIKDMFNSTLEVAKFEGAKIRTVSGIRGQIKKALNKPQGAFRATFEDKIMLSDIVFCRTWYKVDIPKLYNPVTSLLLPPEQKDSWTGMKTTGQLKRERGLHNDPQFDSMYTVSKVKRTGVYSTRASITLRKAKGKTSLGLFSNPFFTELSKKPKTVFLVMVLPSIWRKATHLLTY

cccccccccccccEEEEcccccccccccccHHHHHcccccCECcccccccccccCECcccccccEEEEEEEECcccEEEEEcEEEEEcccccHHHHHHHcccEEEEEcccccEEEcccccccCEEEEEEccccccccEEEEEEEEECccccCCcccccccccccccccccccCCHHHHHHHcccccccccccccccEEcccccccccccccHHHcccccccccccccccccccccccccEEEEEEcccHHHHHHHHHcc

*****AE*LFVPTARRHKI***********************************ETVEPKVFYAEVTKKLKLTGVPMKIYKKTAFIKDMFNSTLEVAKFEGAKIRTVSGIRGQIKKALNKPQGAFRATFEDKIMLSDIVFCRTWYKVDIPKLYNPVTSLLLPPEQK***T*MKTTGQLKRERG*H*******MYTVSKVKRTGVYSTRASITLRKAKGKTSLGLFSNPFFTELSKKPKTVFLVMVLPSIWRKATHLLT*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ribosome biogenesis protein bms1	May act as a molecular switch during maturation of the 40S ribosomal subunit in the nucleolus.	confident	O94653
Ribosome biogenesis protein BMS1	May act as a molecular switch during maturation of the 40S ribosomal subunit in the nucleolus. The depletion of BMS1 interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits.	confident	Q08965
Ribosome biogenesis protein BMS1 homolog	May act as a molecular switch during maturation of the 40S ribosomal subunit in the nucleolus.	confident	Q14692

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0034511 [MF]	U3 snoRNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0030515, GO:1901363, GO:0003723
GO:0030686 [CC]	90S preribosome	probable	GO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0042255 [BP]	ribosome assembly	probable	GO:0006996, GO:0071826, GO:0022607, GO:0043933, GO:0009987, GO:0042254, GO:0016043, GO:0065003, GO:0022618, GO:0044763, GO:0071840, GO:0034622, GO:0022613, GO:0008150, GO:0070925, GO:0044699, GO:0044085
GO:0006364 [BP]	rRNA processing	probable	GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005819 [CC]	spindle	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WB1, chain A
Confidence level:confident
Coverage over the Query: 54-147
View the alignment between query and template
View the model in PyMOL