Diaphorina citri psyllid: psy5903


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MDSTLCSLLLSDIRVKRGSSEKRVVCYYTNWSVYRPGTAKFTPQNINPYLCTHLIYAFGGLDKENGLRPFDKYQDIEQGKTFPPLSSCANVQGCLTPTRWHQNLVFYSLERHYFRSHGKHMK
cHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccccccccEEEEEEEEEcccccEEEccccHHHHHHcccccccEEEEECcccccccccccccccHHHHHHHHHHHHccc
*DSTLCSLLLSDIRVKRGSSEKRVVCYYTNWSVYRPGTAKFTPQNINPYLCTHLIYAFGGLDKENGLRPFDKYQDIEQGKTFPPLSSCANVQGCLTPTRWHQNLVFYSLERHYFRSHGKHMK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSTLCSLLLSDIRVKRGSSEKRVVCYYTNWSVYRPGTAKFTPQNINPYLCTHLIYAFGGLDKENGLRPFDKYQDIEQGKTFPPLSSCANVQGCLTPTRWHQNLVFYSLERHYFRSHGKHMK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008061 [MF]chitin bindingprobableGO:0097367, GO:0003674, GO:0005488
GO:0004568 [MF]chitinase activityprobableGO:0016787, GO:0003824, GO:0003674, GO:0016798, GO:0004553
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0006032 [BP]chitin catabolic processprobableGO:1901575, GO:0043170, GO:1901564, GO:1901565, GO:0071704, GO:0006040, GO:1901136, GO:1901135, GO:0046348, GO:0008150, GO:0006022, GO:0006807, GO:0009056, GO:0008152, GO:1901072, GO:0006030, GO:1901071, GO:0006026, GO:0009057
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OA5, chain A
Confidence level:very confident
Coverage over the Query: 18-106
View the alignment between query and template
View the model in PyMOL