Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Protects lung epithelial cells against apoptosis and promotes phosphorylation of AKT1. Its function in the inflammatory response and in protecting cells against apoptosis is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding.
Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Protects lung epithelial cells against apoptosis and promotes phosphorylation of AKT1. Its function in the inflammatory response and in protecting cells against apoptosis is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding.
Score = 65.5 bits (158), Expect = 1e-10, Method: Compositional matrix adjust.
Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 3/83 (3%)
Query: 5 LCSLLLSDIRVKRGSSEKRVVCYYTNWSVYRPGTAKFTPQNINPYLCTHLIYAFGGLDKE 64
L + L+ + V+ GS+ +VCY+TNW+ YRPG F P +INP LCTHLIYAF G+ +
Sbjct: 6 LVTGLVLLLNVQLGSA-YNLVCYFTNWAQYRPGLGSFKPDDINPCLCTHLIYAFAGM--Q 62
Query: 65 NGLRPFDKYQDIEQGKTFPPLSS 87
N ++ D+ K F L +
Sbjct: 63 NNQITTIEWNDVTLYKAFNDLKN 85
Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Protects lung epithelial cells against apoptosis and promotes phosphorylation of AKT1. Its function in the inflammatory response and in protecting cells against apoptosis is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding.
Degrades chitin, chitotriose and chitobiose. May participate in the defense against nematodes and other pathogens. Isoform 3 has no enzymatic activity.
Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Its function in the inflammatory response is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding.
Score = 160 (61.4 bits), Expect = 8.2e-12, P = 8.2e-12
Identities = 40/104 (38%), Positives = 57/104 (54%)
Query: 17 RGSSEKRVVCYYTNWSVYRPGTAKFTPQNINPYLCTHLIYAFGGLDKENGLRPFDK---- 72
+G S ++VCY+TNWS R KFTP+NI+P+LC+HLIY+F ++ N + DK
Sbjct: 22 QGGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIEN-NKVIIKDKSEVM 80
Query: 73 -YQDIEQGKTF-PPLSSCANVQGCLTPTRWHQNLVFYSLERHYF 114
YQ I KT P L ++ G L ++ +V S R F
Sbjct: 81 LYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEF 124
Score = 160 (61.4 bits), Expect = 8.2e-12, P = 8.2e-12
Identities = 40/104 (38%), Positives = 57/104 (54%)
Query: 17 RGSSEKRVVCYYTNWSVYRPGTAKFTPQNINPYLCTHLIYAFGGLDKENGLRPFDK---- 72
+G S ++VCY+TNWS R KFTP+NI+P+LC+HLIY+F ++ N + DK
Sbjct: 22 QGGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIEN-NKVIIKDKSEVM 80
Query: 73 -YQDIEQGKTF-PPLSSCANVQGCLTPTRWHQNLVFYSLERHYF 114
YQ I KT P L ++ G L ++ +V S R F
Sbjct: 81 LYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEF 124
COG3325, ChiA, Chitinase [Carbohydrate transport a
6e-06
>gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases
The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens. Length = 362
Score = 62.1 bits (151), Expect = 2e-12
Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 4/59 (6%)
Query: 22 KRVVCYYTNWSVYRPGTAKFTPQNINPYLCTHLIYAFGGLDKENGLR-PFDKYQDIEQG 79
R+V YYT W Y G F +I TH+IYAF +D D D +G
Sbjct: 1 GRIVGYYTQWGNYGEG---FPLDDIPTDKLTHIIYAFANIDGNGTFGNNADTEDDGLKG 56
Length = 325
>gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster
Score = 50.4 bits (121), Expect = 2e-08
Identities = 19/60 (31%), Positives = 37/60 (61%), Gaps = 3/60 (5%)
Query: 23 RVVCYYTNWSVYRPGTAKFTPQNINPYL--CTHLIYAFGGLDKEN-GLRPFDKYQDIEQG 79
++VCYY + S R G AK + +++ P L CTHL+Y + G+D + ++ ++ D+++
Sbjct: 1 KLVCYYDSKSYLREGLAKMSLEDLEPALQFCTHLVYGYAGIDADTYKIKSLNEDLDLDKS 60
The IDGF's have an eight-stranded alpha/beta barrel fold and are related to the glycosyl hydrolase family 18 (GH18) chitinases, but they have an amino acid substitution known to abolish chitinase catalytic activity. IDGFs may have evolved from chitinases to gain new functions as growth factors, interacting with cell surface glycoproteins involved in growth-promoting processes. Length = 413
>gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites
The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. Length = 322
>gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods
Score = 44.3 bits (105), Expect = 2e-06
Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 4/59 (6%)
Query: 24 VVCYYTNWSVYRPGTAKFTPQNINPYLCTHLIYAFGGLDKENGLRPFDKYQDIEQGKTF 82
V+CYY WS R P +I LCTH+IYAF + + L F +
Sbjct: 1 VICYYDGWSSGRG----PDPTDIPLSLCTHIIYAFAEISSDGSLNLFGDKSEEPLKGAL 55
Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model. Length = 210
>gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism]
GH18_hevamine_XipI_class_III This conserved domain
91.63
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster
The IDGF's have an eight-stranded alpha/beta barrel fold and are related to the glycosyl hydrolase family 18 (GH18) chitinases, but they have an amino acid substitution known to abolish chitinase catalytic activity. IDGFs may have evolved from chitinases to gain new functions as growth factors, interacting with cell surface glycoproteins involved in growth-promoting processes.
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases
The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the la
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism]
Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites
The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes
The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others. Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity. Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway. The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity.
>cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii
2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Some members of this family, GH18 from CAZY, belong to the chitinase class II group which includes chitinase, chitodextrinase and the killer toxin of Kluyveromyces lactis. The chitinases hydrolyse chitin oligosaccharides. The family also includes various glycoproteins from mammals; cartilage glycoprotein and the oviduct-specific glycoproteins are two examples.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 1ITX_A 3ALG_A 3ALF_A 1NAR_A 3QOK_A 3G6L_A 3G6M_A 2DT1_A 2B31_A 2O92_A ....
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas
>cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods
Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are inclu
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L
) cotyledons with unknown function. Narbonin has a glycosyl hydrolase family 18 (GH18) domain without the conserved catalytic residues and with no known enzymatic activity. Narbonin amounts to up to 3% of the total seed globulins of mature seeds and was thought to be a storage protein but was found to degrade too slowly during germination. This family also includes the VfNOD32 nodulin from Vicia faba.
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD)
ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome
SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2. Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages.
>cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain
Members of this domain family are found not only in archaea but also in eukaryotes and prokaryotes. PF-ChiA exhibits hydrolytic activity toward both colloidal and crystalline (beta/alpha) chitins at high temperature.
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination
CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins
The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
>cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain
Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
>pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361
>pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361
>pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361
>pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361
>pdb|1W9P|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human And Bacterial Chitinasefra Length = 433
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Signal processing protein (SPC-40, MGP-40)
species: Sheep (Ovis aries) [TaxId: 9940]
Score = 76.4 bits (187), Expect = 2e-18
Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 3/87 (3%)
Query: 23 RVVCYYTNWSVYRPGTAKFTPQNINPYLCTHLIYAFGGLDKENGLRPFDKYQDIEQGKTF 82
+++CYYT+WS YR G P I+P+LCTH+IY F + N + ++ + D+ T
Sbjct: 2 KLICYYTSWSQYREGDGSCFPDAIDPFLCTHVIYTFANIS-NNEIDTWE-WNDVTLYDTL 59
Query: 83 PPLSSC-ANVQGCLTPTRWHQNLVFYS 108
L + ++ L+ W+ +S
Sbjct: 60 NTLKNRNPKLKTLLSVGGWNFGPERFS 86
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Chitotriosidase
species: Human (Homo sapiens) [TaxId: 9606]
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Chitinase A, catalytic domain
species: Serratia marcescens [TaxId: 615]
Score = 70.2 bits (171), Expect = 5e-16
Identities = 21/69 (30%), Positives = 28/69 (40%), Gaps = 5/69 (7%)
Query: 19 SSEKRVVCYYTNWSVYRPGTAKFTPQNINPYLCTHLIYAFGGLDKENGLRPFDKYQDIEQ 78
+S K V Y+ W VY FT I THL+Y F + NG+ D ++IE
Sbjct: 23 NSGKVVGSYFVEWGVYGR---NFTVDKIPAQNLTHLLYGFIPICGGNGI--NDSLKEIEG 77
Query: 79 GKTFPPLSS 87
S
Sbjct: 78 SFQALQRSC 86
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Psychrophilic chitinase B
species: Arthrobacter sp., tad20 [TaxId: 1667]
Score = 68.0 bits (165), Expect = 3e-15
Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 1/49 (2%)
Query: 19 SSEKRVVCYYTNWSVY-RPGTAKFTPQNINPYLCTHLIYAFGGLDKENG 66
+ R V Y+ W VY R AK + TH+ Y+FG ++ +
Sbjct: 6 VNGYRNVGYFAQWGVYGRAFQAKQLDVSGTAKNLTHINYSFGNINNQTL 54
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Endo-beta-N-acetylglucosaminidase
species: Streptomyces plicatus, endoglycosidase H [TaxId: 1922]
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Endo-beta-N-acetylglucosaminidase
species: Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Chitinase A, catalytic domain
species: Serratia marcescens [TaxId: 615]
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Chitotriosidase
species: Human (Homo sapiens) [TaxId: 9606]
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Signal processing protein (SPC-40, MGP-40)
species: Sheep (Ovis aries) [TaxId: 9940]
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Psychrophilic chitinase B
species: Arthrobacter sp., tad20 [TaxId: 1667]
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Endo-beta-N-acetylglucosaminidase
species: Streptomyces plicatus, endoglycosidase H [TaxId: 1922]
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Endo-beta-N-acetylglucosaminidase
species: Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Seed storage protein
species: Vicia narbonensis, Narbonin [TaxId: 3912]
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Hevamine A (chitinase/lysozyme)
species: Para rubber tree (Hevea brasiliensis) [TaxId: 3981]
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Xylanase inhibitor protein I, XIP-I
species: Wheat (Triticum aestivum) [TaxId: 4565]
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Type II chitinase
domain: Seed storage protein
species: Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]
