Diaphorina citri psyllid: psy5910


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MELDRHIIGQHETKKIVSVGVYNHYKRLFLLKSKNIYLEKSNILLVGPTGCGKTLMVKTLAKIINVPIIVVDATSFTEAGYVGDDVESIIQKLLHECDYDVELAEQSIIYIDEIDKISKKTDVVSGKDVSGEGVQQSLLKLIEGVNLSITSLAEKKNPSQNPQVFNIDTTNILFIAGGAFSGIENFIINRINQETNFLEKLNNNYNLICETNTEDLINFGIIPVL
cccccccccccccccEEEEEEEcccccccccccccEEECccCEEEEccccccHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHHHccccHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccEEECccCEEEEEccccccHHHHHHHHHcccccccccccccHHHcccccccHHHHccccccc
MELDRHIIGQHETKKIVSVGVYNHYKRLFLLKSKNIYLEKSNILLVGPTGCGKTLMVKTLAKIINVPIIVVDATSFTEAGYVGDDVESIIQKLLHECDYDVELAEQSIIYIDEIDKISKKTDV*SGKDVSGEGVQQSLLKLIEGVNLSITSLAEKKNPSQNPQVFNIDTTNILFIAGGAFSGIENFIINRINQETNFLEKLNNNYNLICETNTEDLINFGIIPVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELDRHIIGQHETKKIVSVGVYNHYKRLFLLKSKNIYLEKSNILLVGPTGCGKTLMVKTLAKIINVPIIVVDATSFTEAGYVGDDVESIIQKLLHECDYDVELAEQSIIYIDEIDKISKKTDVVSGKDVSGEGVQQSLLKLIEGVNLSITSLAEKKNPSQNPQVFNIDTTNILFIAGGAFSGIENFIINRINQETNFLEKLNNNYNLICETNTEDLINFGIIPVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent Clp protease ATP-binding subunit ClpX ATP-dependent specificity component of the Clp protease. It directs the protease to specific substrates. Can perform chaperone functions in the absence of ClpP.confidentB4EBM2
ATP-dependent Clp protease ATP-binding subunit ClpX ATP-dependent specificity component of the Clp protease. It directs the protease to specific substrates. Can perform chaperone functions in the absence of ClpP.confidentA3NWA5
ATP-dependent Clp protease ATP-binding subunit ClpX ATP-dependent specificity component of the Clp protease. It directs the protease to specific substrates. Can perform chaperone functions in the absence of ClpP.confidentB7VB75

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042645 [CC]mitochondrial nucleoidprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0009295, GO:0005759, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0010952 [BP]positive regulation of peptidase activityprobableGO:0051336, GO:0019222, GO:0051345, GO:0052547, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0044434 [CC]chloroplast partprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0004176 [MF]ATP-dependent peptidase activityprobableGO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0070011, GO:0003674, GO:0016887, GO:0008233
GO:0016235 [CC]aggresomeprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0016234, GO:0044424
GO:0009841 [CC]mitochondrial endopeptidase Clp complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0005739, GO:0005759, GO:0009368, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0051603 [BP]proteolysis involved in cellular protein catabolic processprobableGO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0009056, GO:0009057
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016504 [MF]peptidase activator activityprobableGO:0030234, GO:0061134, GO:0003674, GO:0008047
GO:0031967 [CC]organelle envelopeprobableGO:0005575, GO:0044464, GO:0005623, GO:0031975, GO:0044446, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UM8, chain A
Confidence level:very confident
Coverage over the Query: 2-117,131-148,166-224
View the alignment between query and template
View the model in PyMOL