Psyllid ID: psy5910
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 225 | ||||||
| 400404347 | 356 | ATP-dependent Clp protease ATP-binding s | 0.991 | 0.626 | 0.829 | 2e-98 | |
| 116334975 | 355 | ATP-dependent protease ATP-binding subun | 0.977 | 0.619 | 0.789 | 4e-92 | |
| 400404573 | 355 | ATP-dependent Clp protease ATP-binding s | 0.986 | 0.625 | 0.798 | 8e-91 | |
| 400403869 | 348 | ATP-dependent Clp protease ATP-binding s | 0.986 | 0.637 | 0.748 | 5e-89 | |
| 400404796 | 355 | ATP-dependent Clp protease ATP-binding s | 0.977 | 0.619 | 0.753 | 3e-88 | |
| 400404107 | 348 | ATP-dependent Clp protease ATP-binding s | 0.986 | 0.637 | 0.766 | 4e-85 | |
| 406708291 | 417 | endopeptidase Clp ATP-binding regulatory | 0.977 | 0.527 | 0.551 | 9e-63 | |
| 291614262 | 418 | ATP-dependent Clp protease ATP-binding p | 0.977 | 0.526 | 0.552 | 3e-62 | |
| 73541075 | 425 | ATP-dependent protease ATP-binding subun | 0.982 | 0.52 | 0.536 | 4e-62 | |
| 395762550 | 422 | ATP-dependent protease ATP-binding subun | 0.982 | 0.523 | 0.545 | 5e-62 |
| >gi|400404347|ref|YP_006587367.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Carsonella ruddii HC isolate Thao2000] gi|400362868|gb|AFP83939.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Carsonella ruddii HC isolate Thao2000] | Back alignment and taxonomy information |
|---|
Score = 364 bits (934), Expect = 2e-98, Method: Compositional matrix adjust.
Identities = 185/223 (82%), Positives = 209/223 (93%)
Query: 1 MELDRHIIGQHETKKIVSVGVYNHYKRLFLLKSKNIYLEKSNILLVGPTGCGKTLMVKTL 60
+ELDR+I+GQHETKKI+SVGVYNHYK+L LLK+KNIYLEKSNILL+GPTGCGKTLMVKTL
Sbjct: 22 IELDRYIVGQHETKKIISVGVYNHYKKLHLLKTKNIYLEKSNILLIGPTGCGKTLMVKTL 81
Query: 61 AKIINVPIIVVDATSFTEAGYVGDDVESIIQKLLHECDYDVELAEQSIIYIDEIDKISKK 120
AKIINVPIIVVDATSFTEAGYVGDDVESIIQKLLHEC+Y+VELAE+SIIYIDEIDKISKK
Sbjct: 82 AKIINVPIIVVDATSFTEAGYVGDDVESIIQKLLHECEYNVELAEKSIIYIDEIDKISKK 141
Query: 121 TDVVSGKDVSGEGVQQSLLKLIEGVNLSITSLAEKKNPSQNPQVFNIDTTNILFIAGGAF 180
TD SGKDVSGEGVQQSLLKLIEGVNL+I SL +KKN QN Q FN+DTTNILFIAGGAF
Sbjct: 142 TDYNSGKDVSGEGVQQSLLKLIEGVNLTINSLLDKKNQQQNNQTFNLDTTNILFIAGGAF 201
Query: 181 SGIENFIINRINQETNFLEKLNNNYNLICETNTEDLINFGIIP 223
SGIENF+ +RI++ET+F++K +N NL+ +TN+EDLINFGIIP
Sbjct: 202 SGIENFVFDRISKETSFIDKAVDNNNLLFKTNSEDLINFGIIP 244
|
Source: Candidatus Carsonella ruddii HC isolate Thao2000 Species: Candidatus Carsonella ruddii Genus: Candidatus Carsonella Family: Order: Class: Gammaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|116334975|ref|YP_802470.1| ATP-dependent protease ATP-binding subunit [Candidatus Carsonella ruddii PV] gi|116235256|dbj|BAF35104.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Carsonella ruddii PV] | Back alignment and taxonomy information |
|---|
| >gi|400404573|ref|YP_006587548.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Carsonella ruddii HT isolate Thao2000] gi|400363049|gb|AFP84119.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Carsonella ruddii HT isolate Thao2000] | Back alignment and taxonomy information |
|---|
| >gi|400403869|ref|YP_006586985.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Carsonella ruddii CE isolate Thao2000] gi|400362484|gb|AFP83557.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Carsonella ruddii CE isolate Thao2000] | Back alignment and taxonomy information |
|---|
| >gi|400404796|ref|YP_006587728.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Carsonella ruddii PC isolate NHV] gi|400363231|gb|AFP84300.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Carsonella ruddii PC isolate NHV] | Back alignment and taxonomy information |
|---|
| >gi|400404107|ref|YP_006587175.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Carsonella ruddii CS isolate Thao2000] gi|400362675|gb|AFP83747.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Carsonella ruddii CS isolate Thao2000] | Back alignment and taxonomy information |
|---|
| >gi|406708291|ref|YP_006758643.1| endopeptidase Clp ATP-binding regulatory subunit ClpX [alpha proteobacterium HIMB59] gi|406654067|gb|AFS49466.1| endopeptidase Clp ATP-binding regulatory subunit ClpX [alpha proteobacterium HIMB59] | Back alignment and taxonomy information |
|---|
| >gi|291614262|ref|YP_003524419.1| ATP-dependent Clp protease ATP-binding protein ClpX [Sideroxydans lithotrophicus ES-1] gi|291584374|gb|ADE12032.1| ATP-dependent Clp protease, ATP-binding subunit ClpX [Sideroxydans lithotrophicus ES-1] | Back alignment and taxonomy information |
|---|
| >gi|73541075|ref|YP_295595.1| ATP-dependent protease ATP-binding subunit ClpX [Ralstonia eutropha JMP134] gi|123760219|sp|Q472D2.1|CLPX_RALEJ RecName: Full=ATP-dependent Clp protease ATP-binding subunit ClpX gi|72118488|gb|AAZ60751.1| ATP-dependent Clp protease ATP-binding subunit ClpX [Ralstonia eutropha JMP134] | Back alignment and taxonomy information |
|---|
| >gi|395762550|ref|ZP_10443219.1| ATP-dependent protease ATP-binding subunit ClpX [Janthinobacterium lividum PAMC 25724] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 225 | ||||||
| TIGR_CMR|NSE_0753 | 400 | NSE_0753 "ATP-dependent Clp pr | 0.964 | 0.542 | 0.530 | 4.2e-56 | |
| TIGR_CMR|CHY_0326 | 418 | CHY_0326 "ATP-dependent Clp pr | 0.973 | 0.523 | 0.519 | 2.9e-55 | |
| TIGR_CMR|CBU_0739 | 422 | CBU_0739 "ATP-dependent Clp pr | 0.973 | 0.518 | 0.528 | 6.1e-55 | |
| TIGR_CMR|BA_4704 | 419 | BA_4704 "ATP-dependent Clp pro | 0.973 | 0.522 | 0.526 | 9.9e-55 | |
| TIGR_CMR|GSU_1791 | 417 | GSU_1791 "ATP-dependent Clp pr | 0.973 | 0.525 | 0.510 | 9.9e-55 | |
| UNIPROTKB|P0A6H1 | 424 | clpX "ClpX" [Escherichia coli | 0.973 | 0.516 | 0.506 | 1.6e-54 | |
| TIGR_CMR|ECH_0900 | 406 | ECH_0900 "ATP-dependent Clp pr | 0.968 | 0.536 | 0.495 | 4.3e-54 | |
| TIGR_CMR|SO_1795 | 426 | SO_1795 "ATP-dependent Clp pro | 0.973 | 0.514 | 0.519 | 5.5e-54 | |
| UNIPROTKB|Q9KQS7 | 426 | clpX "ATP-dependent Clp protea | 0.973 | 0.514 | 0.504 | 8.9e-54 | |
| TIGR_CMR|CJE_0324 | 407 | CJE_0324 "ATP-dependent Clp pr | 0.982 | 0.542 | 0.508 | 8.9e-54 |
| TIGR_CMR|NSE_0753 NSE_0753 "ATP-dependent Clp protease, ATP-binding subunit ClpX" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] | Back alignment and assigned GO terms |
|---|
Score = 578 (208.5 bits), Expect = 4.2e-56, P = 4.2e-56
Identities = 121/228 (53%), Positives = 160/228 (70%)
Query: 4 DRHIIGQHETKKIVSVGVYNHYKRLFL---LKSKNIYLEKSNILLVGPTGCGKTLMVKTL 60
D I Q + KKI+SV VYNHYK F+ L SK++ + KSNIL++GPTGCGKTL KTL
Sbjct: 68 DSFITAQEDAKKILSVAVYNHYK-CFVGNRLNSKDVEITKSNILIIGPTGCGKTLFAKTL 126
Query: 61 AKIINVPIIVVDATSFTEAGYVGDDVESIIQKLLHECDYDVELAEQSIIYIDEIDKISKK 120
A+ +NVP + DATS TEAGYVGDDVE+I++ LL DY+VE A++ I+YIDEIDKIS+K
Sbjct: 127 ARFLNVPFAICDATSITEAGYVGDDVENILRMLLQSADYNVEAAQKGIVYIDEIDKISRK 186
Query: 121 TDVVS-GKDVSGEGVQQSLLKLIEGVNLSITSLAEKKNPSQNPQVFNIDTTNILFIAGGA 179
+D S +DVSGEGVQQ+LLK++EG S+ +K+P+Q + IDTTNILFI GGA
Sbjct: 187 SDSPSITRDVSGEGVQQALLKIMEGTIASVPPQGGRKHPNQ--ETIQIDTTNILFICGGA 244
Query: 180 FSGIENFIINRINQET-NFLEKLNNNY---NLICETNTEDLINFGIIP 223
F G++N I NR + T F +L + ++ + EDL+ FG+IP
Sbjct: 245 FVGLDNIIANRQSINTMGFKSELQSKEVSPTILKKVEPEDLVKFGMIP 292
|
|
| TIGR_CMR|CHY_0326 CHY_0326 "ATP-dependent Clp protease, ATP-binding subunit ClpX" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0739 CBU_0739 "ATP-dependent Clp protease, ATP-binding subunit ClpX" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4704 BA_4704 "ATP-dependent Clp protease, ATP-binding subunit ClpX" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1791 GSU_1791 "ATP-dependent Clp protease, ATP-binding subunit ClpX" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A6H1 clpX "ClpX" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_0900 ECH_0900 "ATP-dependent Clp protease, ATP-binding subunit ClpX" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1795 SO_1795 "ATP-dependent Clp protease, ATP-binding subunit ClpX" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KQS7 clpX "ATP-dependent Clp protease ATP-binding subunit ClpX" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_0324 CJE_0324 "ATP-dependent Clp protease, ATP-binding subunit ClpX" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 225 | |||
| PRK05342 | 412 | PRK05342, clpX, ATP-dependent protease ATP-binding | 1e-110 | |
| COG1219 | 408 | COG1219, ClpX, ATP-dependent protease Clp, ATPase | 1e-101 | |
| TIGR00382 | 413 | TIGR00382, clpX, endopeptidase Clp ATP-binding reg | 9e-87 | |
| pfam07724 | 168 | pfam07724, AAA_2, AAA domain (Cdc48 subfamily) | 8e-27 | |
| COG1220 | 444 | COG1220, HslU, ATP-dependent protease HslVU (ClpYQ | 2e-26 | |
| PRK05201 | 443 | PRK05201, hslU, ATP-dependent protease ATP-binding | 5e-26 | |
| TIGR00390 | 441 | TIGR00390, hslU, ATP-dependent protease HslVU, ATP | 2e-24 | |
| pfam00004 | 131 | pfam00004, AAA, ATPase family associated with vari | 2e-16 | |
| PRK05201 | 443 | PRK05201, hslU, ATP-dependent protease ATP-binding | 1e-15 | |
| COG1220 | 444 | COG1220, HslU, ATP-dependent protease HslVU (ClpYQ | 1e-14 | |
| cd00009 | 151 | cd00009, AAA, The AAA+ (ATPases Associated with a | 6e-14 | |
| TIGR00390 | 441 | TIGR00390, hslU, ATP-dependent protease HslVU, ATP | 7e-11 | |
| COG0714 | 329 | COG0714, COG0714, MoxR-like ATPases [General funct | 9e-11 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 1e-10 | |
| TIGR01242 | 364 | TIGR01242, 26Sp45, 26S proteasome subunit P45 fami | 6e-10 | |
| COG1223 | 368 | COG1223, COG1223, Predicted ATPase (AAA+ superfami | 6e-10 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 3e-09 | |
| COG1222 | 406 | COG1222, RPT1, ATP-dependent 26S proteasome regula | 4e-08 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 1e-06 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 1e-06 | |
| PTZ00454 | 398 | PTZ00454, PTZ00454, 26S protease regulatory subuni | 2e-06 | |
| pfam07728 | 135 | pfam07728, AAA_5, AAA domain (dynein-related subfa | 5e-06 | |
| COG0542 | 786 | COG0542, clpA, ATP-binding subunits of Clp proteas | 6e-06 | |
| PRK10733 | 644 | PRK10733, hflB, ATP-dependent metalloprotease; Rev | 7e-06 | |
| CHL00176 | 638 | CHL00176, ftsH, cell division protein; Validated | 9e-06 | |
| TIGR01241 | 495 | TIGR01241, FtsH_fam, ATP-dependent metalloprotease | 4e-05 | |
| COG0542 | 786 | COG0542, clpA, ATP-binding subunits of Clp proteas | 7e-05 | |
| PTZ00361 | 438 | PTZ00361, PTZ00361, 26 proteosome regulatory subun | 8e-05 | |
| COG0324 | 308 | COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosph | 2e-04 | |
| TIGR02639 | 730 | TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi | 3e-04 | |
| pfam13191 | 154 | pfam13191, AAA_16, AAA ATPase domain | 5e-04 | |
| COG2256 | 436 | COG2256, MGS1, ATPase related to the helicase subu | 0.001 | |
| PRK13342 | 413 | PRK13342, PRK13342, recombination factor protein R | 0.001 | |
| PRK00091 | 307 | PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosp | 0.001 | |
| TIGR01243 | 733 | TIGR01243, CDC48, AAA family ATPase, CDC48 subfami | 0.002 | |
| pfam13401 | 124 | pfam13401, AAA_22, AAA domain | 0.002 | |
| pfam13207 | 114 | pfam13207, AAA_17, AAA domain | 0.002 | |
| COG0465 | 596 | COG0465, HflB, ATP-dependent Zn proteases [Posttra | 0.002 |
| >gnl|CDD|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
Score = 323 bits (830), Expect = e-110
Identities = 117/231 (50%), Positives = 159/231 (68%), Gaps = 12/231 (5%)
Query: 3 LDRHIIGQHETKKIVSVGVYNHYKRLFLLKSKN--IYLEKSNILLVGPTGCGKTLMVKTL 60
LD+++IGQ KK++SV VYNHYKRL K+ + L+KSNILL+GPTG GKTL+ +TL
Sbjct: 69 LDQYVIGQERAKKVLSVAVYNHYKRLRHGDKKDDDVELQKSNILLIGPTGSGKTLLAQTL 128
Query: 61 AKIINVPIIVVDATSFTEAGYVGDDVESIIQKLLHECDYDVELAEQSIIYIDEIDKISKK 120
A+I++VP + DAT+ TEAGYVG+DVE+I+ KLL DYDVE A++ I+YIDEIDKI++K
Sbjct: 129 ARILDVPFAIADATTLTEAGYVGEDVENILLKLLQAADYDVEKAQRGIVYIDEIDKIARK 188
Query: 121 TDVVSG-KDVSGEGVQQSLLKLIEGVNLSITSLAEKKNPSQNPQVFNIDTTNILFIAGGA 179
++ S +DVSGEGVQQ+LLK++EG S+ +K+P Q + +DTTNILFI GGA
Sbjct: 189 SENPSITRDVSGEGVQQALLKILEGTVASVPPQGGRKHPQQ--EFIQVDTTNILFICGGA 246
Query: 180 FSGIENFIINRIN-------QETNFLEKLNNNYNLICETNTEDLINFGIIP 223
F G+E I R+ E ++ L+ + EDLI FG+IP
Sbjct: 247 FDGLEKIIKQRLGKKGIGFGAEVKSKKEKRTEGELLKQVEPEDLIKFGLIP 297
|
Length = 412 |
| >gnl|CDD|224140 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) | Back alignment and domain information |
|---|
| >gnl|CDD|224141 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|235364 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213527 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|235364 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224141 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >gnl|CDD|213527 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) | Back alignment and domain information |
|---|
| >gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223401 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain | Back alignment and domain information |
|---|
| >gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234626 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|222104 pfam13401, AAA_22, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221983 pfam13207, AAA_17, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 225 | |||
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 100.0 | |
| KOG0745|consensus | 564 | 100.0 | ||
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 100.0 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 100.0 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 100.0 | |
| KOG0738|consensus | 491 | 100.0 | ||
| KOG0730|consensus | 693 | 99.97 | ||
| KOG0733|consensus | 802 | 99.97 | ||
| KOG0739|consensus | 439 | 99.97 | ||
| KOG0736|consensus | 953 | 99.97 | ||
| KOG0733|consensus | 802 | 99.97 | ||
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 99.96 | |
| KOG0727|consensus | 408 | 99.96 | ||
| KOG0734|consensus | 752 | 99.96 | ||
| KOG0728|consensus | 404 | 99.95 | ||
| KOG0652|consensus | 424 | 99.95 | ||
| KOG0737|consensus | 386 | 99.94 | ||
| KOG0726|consensus | 440 | 99.94 | ||
| KOG0735|consensus | 952 | 99.94 | ||
| KOG0731|consensus | 774 | 99.93 | ||
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.93 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 99.93 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 99.93 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 99.93 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 99.92 | |
| KOG0729|consensus | 435 | 99.92 | ||
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.92 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.92 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 99.92 | |
| KOG0651|consensus | 388 | 99.91 | ||
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 99.91 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 99.91 | |
| KOG0740|consensus | 428 | 99.91 | ||
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 99.91 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 99.9 | |
| COG1220 | 444 | HslU ATP-dependent protease HslVU (ClpYQ), ATPase | 99.9 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 99.88 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 99.87 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 99.86 | |
| KOG0730|consensus | 693 | 99.85 | ||
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 99.85 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 99.85 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 99.85 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.85 | |
| KOG0732|consensus | 1080 | 99.84 | ||
| KOG0744|consensus | 423 | 99.84 | ||
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 99.84 | |
| KOG2004|consensus | 906 | 99.84 | ||
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 99.83 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 99.83 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 99.83 | |
| KOG0741|consensus | 744 | 99.82 | ||
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.82 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 99.82 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 99.82 | |
| KOG0742|consensus | 630 | 99.82 | ||
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 99.81 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 99.8 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.8 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 99.79 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 99.78 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 99.76 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 99.76 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 99.74 | |
| KOG0743|consensus | 457 | 99.74 | ||
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 99.72 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 99.72 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 99.71 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.71 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 99.71 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.71 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 99.69 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 99.69 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 99.69 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 99.68 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 99.68 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 99.68 | |
| COG3604 | 550 | FhlA Transcriptional regulator containing GAF, AAA | 99.68 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 99.67 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 99.66 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 99.66 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 99.65 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 99.64 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 99.64 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 99.64 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 99.64 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 99.63 | |
| PHA02244 | 383 | ATPase-like protein | 99.63 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 99.63 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 99.62 | |
| KOG0989|consensus | 346 | 99.62 | ||
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.62 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 99.62 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 99.62 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 99.61 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.61 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 99.61 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 99.6 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 99.59 | |
| KOG1051|consensus | 898 | 99.59 | ||
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 99.58 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 99.58 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 99.58 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 99.58 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 99.57 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 99.57 | |
| KOG2028|consensus | 554 | 99.56 | ||
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 99.54 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 99.54 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 99.54 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 99.53 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 99.53 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 99.52 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 99.52 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 99.52 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 99.52 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 99.52 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 99.52 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 99.51 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 99.51 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 99.51 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 99.5 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 99.5 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 99.5 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 99.5 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 99.49 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 99.49 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 99.49 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 99.49 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 99.49 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 99.49 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 99.48 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 99.48 | |
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 99.46 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 99.46 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 99.46 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 99.46 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 99.46 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 99.45 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 99.45 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 99.44 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 99.44 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 99.44 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 99.44 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 99.43 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 99.43 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 99.43 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 99.43 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 99.43 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 99.41 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 99.41 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 99.41 | |
| KOG0991|consensus | 333 | 99.41 | ||
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 99.4 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 99.4 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 99.4 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 99.4 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 99.38 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 99.38 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 99.36 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 99.34 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 99.34 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 99.34 | |
| KOG0736|consensus | 953 | 99.33 | ||
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 99.33 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 99.32 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 99.32 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 99.32 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 99.31 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 99.31 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 99.31 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 99.3 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 99.3 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 99.3 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 99.3 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 99.29 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 99.29 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 99.27 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 99.26 | |
| KOG0735|consensus | 952 | 99.26 | ||
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 99.23 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 99.22 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 99.22 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 99.21 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 99.2 | |
| PRK08727 | 233 | hypothetical protein; Validated | 99.18 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 99.18 | |
| COG3283 | 511 | TyrR Transcriptional regulator of aromatic amino a | 99.17 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 99.17 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 99.15 | |
| KOG1969|consensus | 877 | 99.14 | ||
| KOG2170|consensus | 344 | 99.14 | ||
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 99.14 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 99.14 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 99.13 | |
| PRK06526 | 254 | transposase; Provisional | 99.13 | |
| COG1241 | 682 | MCM2 Predicted ATPase involved in replication cont | 99.12 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 99.11 | |
| PRK08181 | 269 | transposase; Validated | 99.11 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 99.11 | |
| PF00493 | 331 | MCM: MCM2/3/5 family This family extends the MCM d | 99.11 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 99.1 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 99.1 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 99.09 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 99.08 | |
| PRK12377 | 248 | putative replication protein; Provisional | 99.07 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 99.07 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 99.07 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 99.06 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 99.05 | |
| KOG0480|consensus | 764 | 99.04 | ||
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 99.03 | |
| COG3284 | 606 | AcoR Transcriptional activator of acetoin/glycerol | 99.02 | |
| KOG0478|consensus | 804 | 99.01 | ||
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 99.01 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 99.0 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 99.0 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 98.99 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 98.97 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 98.95 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 98.95 | |
| KOG0482|consensus | 721 | 98.95 | ||
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 98.94 | |
| PRK08116 | 268 | hypothetical protein; Validated | 98.93 | |
| KOG2035|consensus | 351 | 98.91 | ||
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 98.9 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 98.89 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.88 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 98.87 | |
| PRK06620 | 214 | hypothetical protein; Validated | 98.86 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 98.86 | |
| KOG0477|consensus | 854 | 98.85 | ||
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 98.84 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 98.84 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 98.83 | |
| KOG0990|consensus | 360 | 98.82 | ||
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 98.81 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 98.8 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 98.8 | |
| KOG0741|consensus | 744 | 98.79 | ||
| KOG1942|consensus | 456 | 98.79 | ||
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 98.77 | |
| KOG0481|consensus | 729 | 98.74 | ||
| COG4650 | 531 | RtcR Sigma54-dependent transcription regulator con | 98.74 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 98.73 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 98.72 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 98.72 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.71 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 98.7 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 98.66 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 98.66 | |
| PRK09087 | 226 | hypothetical protein; Validated | 98.64 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 98.63 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 98.6 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 98.58 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 98.58 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 98.57 | |
| KOG0479|consensus | 818 | 98.56 | ||
| PRK05818 | 261 | DNA polymerase III subunit delta'; Validated | 98.52 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 98.51 | |
| KOG3347|consensus | 176 | 98.5 | ||
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 98.5 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 98.5 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 98.48 | |
| PRK07276 | 290 | DNA polymerase III subunit delta'; Validated | 98.48 | |
| PHA02624 | 647 | large T antigen; Provisional | 98.47 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 98.46 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 98.46 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 98.45 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 98.45 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 98.44 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 98.4 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 98.39 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 98.39 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 98.38 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 98.38 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 98.37 | |
| KOG0058|consensus | 716 | 98.37 | ||
| PRK07261 | 171 | topology modulation protein; Provisional | 98.35 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 98.35 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 98.35 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 98.33 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 98.29 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 98.29 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 98.28 | |
| KOG2680|consensus | 454 | 98.27 | ||
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 98.26 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 98.23 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.23 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 98.22 | |
| KOG1514|consensus | 767 | 98.19 | ||
| KOG0056|consensus | 790 | 98.19 | ||
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 98.17 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 98.17 | |
| PRK03839 | 180 | putative kinase; Provisional | 98.17 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 98.17 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 98.17 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 98.16 | |
| PHA02774 | 613 | E1; Provisional | 98.15 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 98.15 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 98.14 | |
| KOG1970|consensus | 634 | 98.13 | ||
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 98.13 | |
| KOG0055|consensus | 1228 | 98.13 | ||
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 98.12 | |
| PRK06217 | 183 | hypothetical protein; Validated | 98.12 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 98.11 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 98.11 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.1 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 98.1 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 98.09 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 98.09 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 98.08 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 98.08 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 98.06 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 98.06 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 98.06 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 98.05 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 98.05 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 98.04 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 98.04 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 98.04 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 98.04 | |
| KOG2227|consensus | 529 | 98.02 | ||
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 98.02 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 98.02 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 98.01 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 98.0 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 98.0 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 98.0 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 97.99 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 97.98 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 97.98 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 97.98 | |
| KOG1808|consensus | 1856 | 97.97 | ||
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 97.97 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 97.96 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 97.95 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 97.95 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 97.95 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 97.94 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 97.94 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 97.93 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 97.92 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 97.91 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 97.91 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 97.91 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 97.91 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.9 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 97.9 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 97.9 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 97.9 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 97.9 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 97.89 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 97.89 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 97.89 | |
| KOG0055|consensus | 1228 | 97.89 | ||
| PRK02496 | 184 | adk adenylate kinase; Provisional | 97.89 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 97.89 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 97.89 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 97.88 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 97.88 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 97.87 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 97.86 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 97.86 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 97.86 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 97.86 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 97.85 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 97.85 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 97.85 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 97.85 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.85 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 97.85 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 97.84 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 97.84 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 97.84 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 97.84 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 97.84 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 97.83 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 97.83 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 97.83 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.83 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 97.83 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 97.83 | |
| KOG1051|consensus | 898 | 97.83 | ||
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 97.83 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 97.83 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 97.83 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 97.82 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 97.82 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 97.82 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 97.82 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 97.82 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 97.82 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 97.82 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 97.82 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 97.82 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.81 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 97.81 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 97.81 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 97.81 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 97.81 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 97.81 | |
| PF05272 | 198 | VirE: Virulence-associated protein E; InterPro: IP | 97.81 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 97.81 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 97.81 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 97.81 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 97.8 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 97.8 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 97.8 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 97.8 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 97.8 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 97.8 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 97.8 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 97.8 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 97.8 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 97.8 | |
| PRK06696 | 223 | uridine kinase; Validated | 97.79 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 97.79 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 97.79 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 97.79 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 97.78 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 97.78 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 97.78 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 97.78 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 97.77 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 97.77 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 97.77 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 97.77 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 97.77 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 97.77 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 97.77 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 97.77 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 97.77 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 97.77 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 97.76 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 97.76 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 97.76 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 97.76 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 97.76 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 97.76 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 97.75 | |
| PLN02200 | 234 | adenylate kinase family protein | 97.75 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 97.75 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 97.75 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 97.75 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 97.75 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 97.74 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 97.74 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 97.74 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 97.74 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 97.74 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 97.74 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 97.74 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 97.74 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 97.74 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 97.74 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 97.74 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 97.74 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 97.74 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 97.73 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 97.73 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 97.73 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 97.73 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 97.73 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 97.73 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 97.73 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 97.73 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 97.72 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 97.72 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 97.72 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 97.72 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 97.72 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 97.72 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 97.72 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.72 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 97.72 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 97.72 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 97.72 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.72 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 97.71 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 97.71 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 97.71 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 97.71 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 97.71 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 97.71 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.71 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 97.71 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 97.71 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 97.71 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.7 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 97.7 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 97.7 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 97.7 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 97.7 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 97.7 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 97.69 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 97.69 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.69 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 97.69 |
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-45 Score=288.66 Aligned_cols=222 Identities=54% Similarity=0.876 Sum_probs=208.1
Q ss_pred CCcceeechhhHHhhheeeeEecccceEee-cccceeeeCCcEEEEcCCCCcHHHHHHHHHHHhCCCeEEeccCcccccC
Q psy5910 2 ELDRHIIGQHETKKIVSVGVYNHYKRLFLL-KSKNIYLEKSNILLVGPTGCGKTLMVKTLAKIINVPIIVVDATSFTEAG 80 (225)
Q Consensus 2 ~l~~~i~G~~~~~~~l~~~l~~~~~~~~~~-~~~~~~~~~~~vLl~Gp~GtGKT~la~~ia~~~~~~~~~~~~~~~~~~~ 80 (225)
.||++++||+.+|+.|.-+++++|++.... +..++...+.++||+||+|||||.||+.+|+.++.||..-++..+.++|
T Consensus 58 ~Ld~YVIGQe~AKKvLsVAVYNHYKRl~~~~~~~dvEL~KSNILLiGPTGsGKTlLAqTLAk~LnVPFaiADATtLTEAG 137 (408)
T COG1219 58 HLDEYVIGQEQAKKVLSVAVYNHYKRLNNKEDNDDVELSKSNILLIGPTGSGKTLLAQTLAKILNVPFAIADATTLTEAG 137 (408)
T ss_pred HhhhheecchhhhceeeeeehhHHHHHhccCCCCceeeeeccEEEECCCCCcHHHHHHHHHHHhCCCeeeccccchhhcc
Confidence 589999999999999999999999997654 4455888889999999999999999999999999999999999999999
Q ss_pred ccCCcHHHHHHHHHHhcchhhhhhCCCEEEEcchhhhcccccccC-CCCCChHHHHHHHHHHHhcCCcCccccccccCCC
Q psy5910 81 YVGDDVESIIQKLLHECDYDVELAEQSIIYIDEIDKISKKTDVVS-GKDVSGEGVQQSLLKLIEGVNLSITSLAEKKNPS 159 (225)
Q Consensus 81 ~~g~~~~~~~~~~~~~~~~~~~~~~~~vl~iDEid~l~~~~~~~~-~~~~~~~~~~~~Ll~~l~~~~~~~~~~~~~~~~~ 159 (225)
|+|++++..+..+++.+.+.+++++.+|+||||||++.++..+.+ .++.+++.+|++||+++++...++|..+++.+|.
T Consensus 138 YVGEDVENillkLlqaadydV~rAerGIIyIDEIDKIarkSeN~SITRDVSGEGVQQALLKiiEGTvasVPPqGGRKHP~ 217 (408)
T COG1219 138 YVGEDVENILLKLLQAADYDVERAERGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPQ 217 (408)
T ss_pred ccchhHHHHHHHHHHHcccCHHHHhCCeEEEechhhhhccCCCCCcccccCchHHHHHHHHHHcCceeccCCCCCCCCCc
Confidence 999999999999999999999999999999999999999987777 8899999999999999999999999999999999
Q ss_pred CCCceeEEecCcceeeccCccccHHHHHHhhcccc-cccccccccc------chhcccCChhHHHHccCCCCC
Q psy5910 160 QNPQVFNIDTTNILFIAGGAFSGIENFIINRINQE-TNFLEKLNNN------YNLICETNTEDLINFGIIPVL 225 (225)
Q Consensus 160 ~~~~~~~i~ttn~~~i~~~~~~~l~~al~~Rf~~~-i~~~~~~~~~------~~l~~~~~~~~l~~~~~~~~~ 225 (225)
+. ++-|.|+|++|||.++|.+|+.-+.+|.... |+|....... ..+++.+.|+||.+||+||||
T Consensus 218 Qe--~iqvDT~NILFIcgGAF~GlekiI~~R~~~~~iGF~a~~~~~~~~~~~~~~l~~vepeDLvkFGLIPEf 288 (408)
T COG1219 218 QE--FIQVDTSNILFICGGAFAGLEKIIKKRLGKKGIGFGAEVKSKSKKKEEGELLKQVEPEDLVKFGLIPEF 288 (408)
T ss_pred cc--eEEEcccceeEEeccccccHHHHHHHhccCCcccccccccchhhhhhHHHHHHhcChHHHHHcCCcHHH
Confidence 99 9999999999999999999999999999887 9999876532 678899999999999999997
|
|
| >KOG0745|consensus | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >KOG0738|consensus | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >KOG0739|consensus | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0727|consensus | Back alignment and domain information |
|---|
| >KOG0734|consensus | Back alignment and domain information |
|---|
| >KOG0728|consensus | Back alignment and domain information |
|---|
| >KOG0652|consensus | Back alignment and domain information |
|---|
| >KOG0737|consensus | Back alignment and domain information |
|---|
| >KOG0726|consensus | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >KOG0731|consensus | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0729|consensus | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >KOG0651|consensus | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >KOG0740|consensus | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >KOG0732|consensus | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2004|consensus | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >KOG0741|consensus | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >KOG0742|consensus | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >KOG0743|consensus | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG1051|consensus | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2028|consensus | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >KOG0991|consensus | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >KOG1969|consensus | Back alignment and domain information |
|---|
| >KOG2170|consensus | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0480|consensus | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] | Back alignment and domain information |
|---|
| >KOG0478|consensus | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG0482|consensus | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2035|consensus | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >KOG0477|consensus | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0990|consensus | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0741|consensus | Back alignment and domain information |
|---|
| >KOG1942|consensus | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG0481|consensus | Back alignment and domain information |
|---|
| >COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >KOG0479|consensus | Back alignment and domain information |
|---|
| >PRK05818 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >KOG3347|consensus | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07276 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >KOG0058|consensus | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2680|consensus | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1514|consensus | Back alignment and domain information |
|---|
| >KOG0056|consensus | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1970|consensus | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >KOG0055|consensus | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2227|consensus | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1808|consensus | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >KOG0055|consensus | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >KOG1051|consensus | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 225 | ||||
| 3hte_A | 363 | Crystal Structure Of Nucleotide-Free Hexameric Clpx | 3e-60 | ||
| 3hws_A | 363 | Crystal Structure Of Nucleotide-Bound Hexameric Clp | 4e-60 | ||
| 1um8_A | 376 | Crystal Structure Of Helicobacter Pylori Clpx Lengt | 8e-51 | ||
| 1ofh_A | 310 | Asymmetric Complex Between Hslv And I-domain Delete | 6e-35 | ||
| 1g3i_A | 444 | Crystal Structure Of The Hsluv Protease-Chaperone C | 3e-21 | ||
| 1g3i_A | 444 | Crystal Structure Of The Hsluv Protease-Chaperone C | 5e-08 | ||
| 1g4a_E | 443 | Crystal Structures Of The Hslvu Peptidase-Atpase Co | 1e-20 | ||
| 1g4a_E | 443 | Crystal Structures Of The Hslvu Peptidase-Atpase Co | 5e-08 | ||
| 1do2_A | 442 | Trigonal Crystal Form Of Heat Shock Locus U (Hslu) | 1e-20 | ||
| 1do2_A | 442 | Trigonal Crystal Form Of Heat Shock Locus U (Hslu) | 5e-08 | ||
| 1e94_E | 449 | Hslv-Hslu From E.Coli Length = 449 | 1e-20 | ||
| 1e94_E | 449 | Hslv-Hslu From E.Coli Length = 449 | 5e-08 | ||
| 1im2_A | 444 | Hslu, Haemophilus Influenzae, Selenomethionine Vari | 2e-20 | ||
| 1im2_A | 444 | Hslu, Haemophilus Influenzae, Selenomethionine Vari | 4e-08 | ||
| 2qz4_A | 262 | Human Paraplegin, Aaa Domain In Complex With Adp Le | 4e-08 | ||
| 2r62_A | 268 | Crystal Structure Of Helicobacter Pylori Atp Depend | 1e-07 | ||
| 3h4m_A | 285 | Aaa Atpase Domain Of The Proteasome- Activating Nuc | 2e-06 | ||
| 1lv7_A | 257 | Crystal Structure Of The Aaa Domain Of Ftsh Length | 7e-06 | ||
| 4b4t_K | 428 | Near-Atomic Resolution Structural Model Of The Yeas | 9e-06 | ||
| 1iy2_A | 278 | Crystal Structure Of The Ftsh Atpase Domain From Th | 4e-05 | ||
| 2ce7_A | 476 | Edta Treated Length = 476 | 5e-05 | ||
| 4eiw_A | 508 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 6e-05 | ||
| 1ixz_A | 254 | Crystal Structure Of The Ftsh Atpase Domain From Th | 6e-05 | ||
| 2dhr_A | 499 | Whole Cytosolic Region Of Atp-Dependent Metalloprot | 7e-05 | ||
| 4b4t_L | 437 | Near-Atomic Resolution Structural Model Of The Yeas | 8e-05 | ||
| 3b9p_A | 297 | Spastin Length = 297 | 1e-04 | ||
| 3kds_E | 465 | Apo-ftsh Crystal Structure Length = 465 | 2e-04 | ||
| 3d8b_A | 357 | Crystal Structure Of Human Fidgetin-Like Protein 1 | 3e-04 | ||
| 3vfd_A | 389 | Human Spastin Aaa Domain Length = 389 | 4e-04 | ||
| 4b4t_J | 405 | Near-Atomic Resolution Structural Model Of The Yeas | 8e-04 | ||
| 1ixr_C | 312 | Ruva-Ruvb Complex Length = 312 | 8e-04 | ||
| 1ixs_B | 318 | Structure Of Ruvb Complexed With Ruva Domain Iii Le | 9e-04 | ||
| 1hqc_A | 324 | Structure Of Ruvb From Thermus Thermophilus Hb8 Len | 9e-04 |
| >pdb|3HTE|A Chain A, Crystal Structure Of Nucleotide-Free Hexameric Clpx Length = 363 | Back alignment and structure |
|
| >pdb|3HWS|A Chain A, Crystal Structure Of Nucleotide-Bound Hexameric Clpx Length = 363 | Back alignment and structure |
| >pdb|1UM8|A Chain A, Crystal Structure Of Helicobacter Pylori Clpx Length = 376 | Back alignment and structure |
| >pdb|1OFH|A Chain A, Asymmetric Complex Between Hslv And I-domain Deleted Hslu (h. Influenzae) Length = 310 | Back alignment and structure |
| >pdb|1G3I|A Chain A, Crystal Structure Of The Hsluv Protease-Chaperone Complex Length = 444 | Back alignment and structure |
| >pdb|1G3I|A Chain A, Crystal Structure Of The Hsluv Protease-Chaperone Complex Length = 444 | Back alignment and structure |
| >pdb|1G4A|E Chain E, Crystal Structures Of The Hslvu Peptidase-Atpase Complex Reveal An Atp-Dependent Proteolysis Mechanism Length = 443 | Back alignment and structure |
| >pdb|1G4A|E Chain E, Crystal Structures Of The Hslvu Peptidase-Atpase Complex Reveal An Atp-Dependent Proteolysis Mechanism Length = 443 | Back alignment and structure |
| >pdb|1DO2|A Chain A, Trigonal Crystal Form Of Heat Shock Locus U (Hslu) From Escherichia Coli Length = 442 | Back alignment and structure |
| >pdb|1DO2|A Chain A, Trigonal Crystal Form Of Heat Shock Locus U (Hslu) From Escherichia Coli Length = 442 | Back alignment and structure |
| >pdb|1E94|E Chain E, Hslv-Hslu From E.Coli Length = 449 | Back alignment and structure |
| >pdb|1E94|E Chain E, Hslv-Hslu From E.Coli Length = 449 | Back alignment and structure |
| >pdb|1IM2|A Chain A, Hslu, Haemophilus Influenzae, Selenomethionine Variant Length = 444 | Back alignment and structure |
| >pdb|1IM2|A Chain A, Hslu, Haemophilus Influenzae, Selenomethionine Variant Length = 444 | Back alignment and structure |
| >pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 | Back alignment and structure |
| >pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 | Back alignment and structure |
| >pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 | Back alignment and structure |
| >pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 | Back alignment and structure |
| >pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 | Back alignment and structure |
| >pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 | Back alignment and structure |
| >pdb|2CE7|A Chain A, Edta Treated Length = 476 | Back alignment and structure |
| >pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 | Back alignment and structure |
| >pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 | Back alignment and structure |
| >pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 | Back alignment and structure |
| >pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 | Back alignment and structure |
| >pdb|3B9P|A Chain A, Spastin Length = 297 | Back alignment and structure |
| >pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 | Back alignment and structure |
| >pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 | Back alignment and structure |
| >pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 | Back alignment and structure |
| >pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 | Back alignment and structure |
| >pdb|1IXR|C Chain C, Ruva-Ruvb Complex Length = 312 | Back alignment and structure |
| >pdb|1IXS|B Chain B, Structure Of Ruvb Complexed With Ruva Domain Iii Length = 318 | Back alignment and structure |
| >pdb|1HQC|A Chain A, Structure Of Ruvb From Thermus Thermophilus Hb8 Length = 324 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 225 | |||
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 1e-103 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 1e-100 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 2e-61 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 3e-26 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 2e-10 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 8e-14 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 7e-13 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 6e-07 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 2e-12 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 7e-11 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 1e-08 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 4e-08 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 7e-08 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 1e-07 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 3e-06 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 5e-06 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 1e-05 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 2e-05 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 2e-05 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 2e-05 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-05 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 6e-05 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 8e-05 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 1e-04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 1e-04 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 1e-04 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 1e-04 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 1e-04 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 1e-04 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 1e-04 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 3e-04 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 7e-04 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 4e-04 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 5e-04 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 8e-04 |
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Length = 363 | Back alignment and structure |
|---|
Score = 302 bits (775), Expect = e-103
Identities = 115/231 (49%), Positives = 160/231 (69%), Gaps = 12/231 (5%)
Query: 3 LDRHIIGQHETKKIVSVGVYNHYKRLFLLKSKN-IYLEKSNILLVGPTGCGKTLMVKTLA 61
LD ++IGQ + KK+++V VYNHYKRL + N + L KSNILL+GPTG GKTL+ +TLA
Sbjct: 13 LDDYVIGQEQAKKVLAVAVYNHYKRLRNGDTSNGVELGKSNILLIGPTGSGKTLLAETLA 72
Query: 62 KIINVPIIVVDATSFTEAGYVGDDVESIIQKLLHECDYDVELAEQSIIYIDEIDKISKKT 121
++++VP + DAT+ TEAGYVG+DVE+IIQKLL +CDYDV+ A++ I+YID+IDKIS+K+
Sbjct: 73 RLLDVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQRGIVYIDQIDKISRKS 132
Query: 122 DVVS-GKDVSGEGVQQSLLKLIEGVNLSITSLAEKKNPSQNPQVFNIDTTNILFIAGGAF 180
D S +DVSGEGVQQ+LLKLIEG ++ +K+P Q + +DT+ ILFI GGAF
Sbjct: 133 DNPSITRDVSGEGVQQALLKLIEGTVAAVPPQGGRKHPQQ--EFLQVDTSKILFICGGAF 190
Query: 181 SGIENFIINRI--------NQETNFLEKLNNNYNLICETNTEDLINFGIIP 223
+G++ I +R+ + L+ + EDLI FG+IP
Sbjct: 191 AGLDKVISHRVETGSGIGFGATVKAKSDKASEGELLAQVEPEDLIKFGLIP 241
|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Length = 376 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Length = 444 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Length = 444 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Length = 253 | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Length = 368 | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Length = 331 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Length = 323 | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Length = 316 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 225 | |||
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 99.98 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 99.97 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 99.97 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 99.97 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 99.97 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 99.97 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.96 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.95 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.95 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.94 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.92 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.92 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 99.92 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.91 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.9 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.9 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.89 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 99.89 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 99.89 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.88 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.88 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.88 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.88 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.88 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 99.87 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 99.87 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.87 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.87 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 99.85 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.84 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 99.81 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 99.81 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.81 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 99.8 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 99.8 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.79 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.79 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.78 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.77 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 99.76 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 99.75 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 99.73 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 99.72 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 99.71 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 99.71 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 99.71 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 99.71 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 99.71 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 99.7 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.69 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 99.68 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 99.68 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 99.68 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 99.67 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 99.66 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 99.64 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 99.63 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 99.62 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 99.59 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.59 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 99.56 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.56 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.55 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 99.55 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 99.55 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 99.55 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 99.54 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 99.54 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 99.54 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 99.53 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 99.52 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 99.5 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 99.5 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 99.49 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 99.48 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 99.46 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 99.45 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 99.45 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 99.44 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 99.43 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 99.43 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 99.42 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 99.4 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 99.4 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 99.34 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.19 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 99.15 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 99.07 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.07 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 99.01 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 98.98 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 98.97 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 98.97 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 98.78 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 98.75 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 98.71 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 98.67 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 98.61 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 98.59 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 98.55 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 98.51 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 98.4 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 98.39 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 98.3 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 98.21 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 98.2 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 98.13 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 98.12 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 98.11 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 98.1 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 98.08 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 98.08 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 98.07 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 98.07 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 98.06 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 98.06 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 98.06 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 98.05 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 98.05 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 98.03 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 98.01 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 98.01 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 98.01 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 98.01 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 98.0 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 97.99 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 97.99 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 97.99 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 97.99 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 97.98 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 97.98 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 97.97 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 97.97 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 97.97 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 97.96 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 97.95 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 97.95 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 97.95 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 97.95 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 97.94 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 97.94 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 97.93 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 97.91 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 97.91 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 97.91 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 97.91 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 97.9 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 97.9 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 97.9 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 97.9 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 97.9 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 97.89 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 97.89 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 97.88 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 97.88 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.87 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.86 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 97.86 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 97.86 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 97.86 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 97.86 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 97.85 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 97.85 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 97.85 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.85 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 97.85 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 97.85 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.85 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 97.84 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 97.84 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 97.84 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 97.83 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 97.83 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 97.83 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 97.82 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 97.82 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 97.82 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 97.81 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 97.81 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 97.81 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 97.8 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 97.8 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 97.79 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 97.79 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 97.79 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 97.79 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 97.78 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 97.78 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 97.77 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 97.77 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 97.77 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 97.76 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 97.76 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 97.76 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 97.75 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 97.75 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 97.75 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 97.74 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 97.73 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 97.72 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 97.71 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 97.7 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 97.7 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 97.7 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 97.69 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 97.69 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 97.69 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 97.68 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 97.68 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 97.67 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 97.67 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 97.67 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 97.67 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 97.67 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 97.66 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 97.65 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 97.65 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 97.62 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 97.62 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 97.61 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 97.61 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 97.61 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 97.6 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 97.6 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 97.6 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 97.6 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 97.59 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.59 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 97.59 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 97.57 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.57 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.57 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 97.57 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 97.56 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 97.56 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 97.55 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 97.54 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 97.54 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 97.54 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 97.53 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 97.53 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 97.51 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 97.51 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 97.51 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 97.5 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 97.49 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 97.49 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 97.49 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 97.48 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 97.48 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 97.48 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 97.47 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 97.47 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 97.45 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 97.45 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 97.45 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 97.45 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 97.45 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 97.45 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 97.44 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 97.44 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 97.43 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 97.43 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.43 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 97.42 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 97.42 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.4 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 97.39 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 97.37 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 97.37 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 97.36 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 97.36 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 97.36 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 97.35 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 97.29 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 97.28 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 97.27 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 97.27 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 97.25 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 97.23 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 97.23 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.22 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 97.22 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 97.21 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 97.21 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 97.21 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 97.19 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 97.18 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 97.18 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 97.17 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 97.17 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 97.17 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 97.16 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.16 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 97.15 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 97.11 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 97.11 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 97.11 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 97.11 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 97.1 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 97.08 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 97.07 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 97.06 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 97.05 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 97.04 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 97.04 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.04 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 97.03 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 97.03 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 97.03 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 97.03 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 97.02 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 97.02 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 97.01 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 97.01 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 96.99 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 96.94 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 96.93 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 96.93 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.91 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 96.91 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 96.91 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 96.9 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.87 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 96.87 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 96.87 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 96.87 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.87 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 96.85 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 96.84 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 96.83 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 96.82 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 96.82 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 96.82 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.82 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 96.81 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 96.81 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.79 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 96.78 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 96.77 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 96.76 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 96.74 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 96.74 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 96.73 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 96.73 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 96.69 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 96.68 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 96.67 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 96.67 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 96.67 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 96.66 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 96.62 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 96.61 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 96.6 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 96.6 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 96.59 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 96.58 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 96.58 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 96.54 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 96.54 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 96.53 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 96.52 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 96.51 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 96.5 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 96.49 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 96.45 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 96.45 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 96.45 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 96.45 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 96.43 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 96.42 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 96.42 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 96.4 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 96.38 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 96.38 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 96.37 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 96.36 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 96.36 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 96.36 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 96.36 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 96.35 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 96.34 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 96.33 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 96.32 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 96.32 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 96.31 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 96.29 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 96.27 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 96.27 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 96.27 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 96.26 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 96.25 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 96.23 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 96.23 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 96.23 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 96.21 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 96.21 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 96.2 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 96.2 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 96.2 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 96.19 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 96.18 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 96.18 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 96.16 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 96.16 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 96.16 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 96.14 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 96.14 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 96.13 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 96.13 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 96.1 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 96.1 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 96.09 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 96.09 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 96.08 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 96.08 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 96.07 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 96.07 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 96.06 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 96.06 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 96.02 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 96.01 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 96.01 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 95.99 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 95.99 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 95.99 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 95.99 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 95.98 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 95.98 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 95.97 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 95.97 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 95.96 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 95.96 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 95.96 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 95.95 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 95.94 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 95.94 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 95.94 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 95.94 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 95.93 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 95.93 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 95.92 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 95.91 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 95.91 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 95.91 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 95.9 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 95.9 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 95.9 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 95.9 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 95.88 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 95.86 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 95.85 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 95.85 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 95.85 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 95.84 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 95.84 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 95.83 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 95.81 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 95.81 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 95.8 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 95.79 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 95.78 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 95.77 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 95.76 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 95.76 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 95.75 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 95.75 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 95.74 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 95.73 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 95.72 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 95.72 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 95.72 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 95.72 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 95.71 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 95.71 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 95.71 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 95.71 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 95.7 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 95.7 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 95.69 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 95.68 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 95.68 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 95.67 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 95.66 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 95.66 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 95.64 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 95.62 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 95.61 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 95.61 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 95.6 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 95.59 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 95.57 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 95.57 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 95.57 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 95.57 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 95.55 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 95.54 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 95.52 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 95.51 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 95.51 |
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=99.98 E-value=1.1e-33 Score=236.36 Aligned_cols=173 Identities=24% Similarity=0.347 Sum_probs=147.6
Q ss_pred ceeechhhHHhhheeeeEecccceEeecccceeeeCCcEEEEcCCCCcHHHHHHHHHHHhCCCeEEeccCcccccCccCC
Q psy5910 5 RHIIGQHETKKIVSVGVYNHYKRLFLLKSKNIYLEKSNILLVGPTGCGKTLMVKTLAKIINVPIIVVDATSFTEAGYVGD 84 (225)
Q Consensus 5 ~~i~G~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~vLl~Gp~GtGKT~la~~ia~~~~~~~~~~~~~~~~~~~~~g~ 84 (225)
+.|+|++++|+.|.+.+.+++.++..+...++.. ++++|||||||||||++|+++|++++.+|+.++++++.+ +|.|+
T Consensus 148 ~dIgGl~~~k~~l~e~v~~Pl~~pe~f~~~gi~~-prGvLL~GPPGTGKTllAkAiA~e~~~~f~~v~~s~l~s-k~vGe 225 (405)
T 4b4t_J 148 DMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQ-PKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQ-KYIGE 225 (405)
T ss_dssp GGSCSCHHHHHHHHHHTHHHHHCHHHHHHHTCCC-CCCEEEESCSSSSHHHHHHHHHHHHTCEEEEEEGGGGSC-SSTTH
T ss_pred HHhCCHHHHHHHHHHHHHHHHhCHHHHHhCCCCC-CCceEEeCCCCCCHHHHHHHHHHhhCCCceEEEhHHhhc-cccch
Confidence 4689999999999999999999888888777754 469999999999999999999999999999999999985 79998
Q ss_pred cHHHHHHHHHHhcchhhhhhCCCEEEEcchhhhcccccccC-CCCCChHHHHHHHHHHHhcCCcCccccccccCCCCCCc
Q psy5910 85 DVESIIQKLLHECDYDVELAEQSIIYIDEIDKISKKTDVVS-GKDVSGEGVQQSLLKLIEGVNLSITSLAEKKNPSQNPQ 163 (225)
Q Consensus 85 ~~~~~~~~~~~~~~~~~~~~~~~vl~iDEid~l~~~~~~~~-~~~~~~~~~~~~Ll~~l~~~~~~~~~~~~~~~~~~~~~ 163 (225)
. +..++.+|..+ +...|+||||||+|++++.+.... +.+....++.+.|+..||+... ..+
T Consensus 226 s-e~~vr~lF~~A----r~~aP~IIFiDEiDai~~~R~~~~~~~~~~~~~~l~~lL~~lDg~~~-----------~~~-- 287 (405)
T 4b4t_J 226 G-SRMVRELFVMA----REHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFET-----------SKN-- 287 (405)
T ss_dssp H-HHHHHHHHHHH----HHTCSEEEEEESSSCCTTSCSCSSSGGGGHHHHHHHHHHHHHHTTTC-----------CCC--
T ss_pred H-HHHHHHHHHHH----HHhCCceEeeecchhhccCCCCCCCCCcHHHHHHHHHHHHhhhccCC-----------CCC--
Confidence 7 77888999887 667899999999999998875543 2233445677889999987531 223
Q ss_pred eeEEecCcceeeccCccccHHHHHHh--hcccccccccccccc
Q psy5910 164 VFNIDTTNILFIAGGAFSGIENFIIN--RINQETNFLEKLNNN 204 (225)
Q Consensus 164 ~~~i~ttn~~~i~~~~~~~l~~al~~--Rf~~~i~~~~~~~~~ 204 (225)
+++|+|||. ++.||+|++| |||++|.++.|+.++
T Consensus 288 V~vIaATNr-------pd~LDpAllRpGRfD~~I~i~lPd~~~ 323 (405)
T 4b4t_J 288 IKIIMATNR-------LDILDPALLRPGRIDRKIEFPPPSVAA 323 (405)
T ss_dssp EEEEEEESC-------SSSSCHHHHSTTSSCCEEECCCCCHHH
T ss_pred eEEEeccCC-------hhhCCHhHcCCCcCceEEEcCCcCHHH
Confidence 999999999 7799999999 999999999999876
|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 225 | ||||
| d1um8a_ | 364 | c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 | 2e-46 | |
| d1g41a_ | 443 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 2e-43 | |
| d1g41a_ | 443 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 7e-06 | |
| d1ofha_ | 309 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 9e-39 | |
| d1ixza_ | 247 | c.37.1.20 (A:) AAA domain of cell division protein | 3e-16 | |
| d1r6bx3 | 315 | c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A | 9e-15 | |
| d1lv7a_ | 256 | c.37.1.20 (A:) AAA domain of cell division protein | 2e-14 | |
| d1qvra3 | 315 | c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus | 2e-13 | |
| d2fnaa2 | 283 | c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo | 2e-11 | |
| d1w44a_ | 321 | c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta | 1e-10 | |
| d1svma_ | 362 | c.37.1.20 (A:) Papillomavirus large T antigen heli | 6e-10 | |
| d1ixsb2 | 239 | c.37.1.20 (B:4-242) Holliday junction helicase Ruv | 2e-08 | |
| d1gvnb_ | 273 | c.37.1.21 (B:) Plasmid maintenance system epsilon/ | 1e-07 | |
| d1r7ra3 | 265 | c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p | 3e-07 | |
| d1g8pa_ | 333 | c.37.1.20 (A:) ATPase subunit of magnesium chelata | 4e-06 | |
| d1in4a2 | 238 | c.37.1.20 (A:17-254) Holliday junction helicase Ru | 2e-05 | |
| d1qvra2 | 387 | c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus | 3e-05 | |
| d1d2na_ | 246 | c.37.1.20 (A:) Hexamerization domain of N-ethylmal | 4e-05 | |
| d1e32a2 | 258 | c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p | 1e-04 | |
| d1kaga_ | 169 | c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia | 2e-04 | |
| d1lw7a2 | 192 | c.37.1.1 (A:220-411) Transcriptional regulator Nad | 3e-04 | |
| d1qhxa_ | 178 | c.37.1.3 (A:) Chloramphenicol phosphotransferase { | 4e-04 | |
| d1zp6a1 | 176 | c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { | 4e-04 | |
| d1sxjd2 | 237 | c.37.1.20 (D:26-262) Replication factor C2 {Baker' | 0.001 | |
| d1viaa_ | 161 | c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobact | 0.004 | |
| d1e6ca_ | 170 | c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr | 0.004 | |
| d2iyva1 | 165 | c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycoba | 0.004 |
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: ClpX species: Helicobacter pylori [TaxId: 210]
Score = 154 bits (391), Expect = 2e-46
Identities = 108/245 (44%), Positives = 151/245 (61%), Gaps = 23/245 (9%)
Query: 2 ELDRHIIGQHETKKIVSVGVYNHYKRLFLLK----------------SKNIYLEKSNILL 45
LD ++IGQ + KK+ SV VYNHYKRL + + + L KSNILL
Sbjct: 14 VLDNYVIGQEQAKKVFSVAVYNHYKRLSFKEKLKKQDNQDSNVELEHLEEVELSKSNILL 73
Query: 46 VGPTGCGKTLMVKTLAKIINVPIIVVDATSFTEAGYVGDDVESIIQKLLHECDYDVELAE 105
+GPTG GKTLM +TLAK +++PI + DATS TEAGYVG+DVE+I+ +LL D++V+ A+
Sbjct: 74 IGPTGSGKTLMAQTLAKHLDIPIAISDATSLTEAGYVGEDVENILTRLLQASDWNVQKAQ 133
Query: 106 QSIIYIDEIDKISKKTDVVS-GKDVSGEGVQQSLLKLIEGVNLSITSLAEKKNPSQNPQV 164
+ I++IDEIDKIS+ ++ S +DVSGEGVQQ+LLK++EG ++I +K+P
Sbjct: 134 KGIVFIDEIDKISRLSENRSITRDVSGEGVQQALLKIVEGSLVNIPPKGGRKHPEG--NF 191
Query: 165 FNIDTTNILFIAGGAFSGIENFIINRINQ----ETNFLEKLNNNYNLICETNTEDLINFG 220
IDT++ILFI GAF G+ I R Q T ++ T DL+ +G
Sbjct: 192 IQIDTSDILFICAGAFDGLAEIIKKRTTQNVLGFTQEKMSKKEQEAILHLVQTHDLVTYG 251
Query: 221 IIPVL 225
+IP L
Sbjct: 252 LIPEL 256
|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 387 | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Length = 161 | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 165 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 225 | |||
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 99.96 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 99.96 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.96 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 99.96 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.95 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.94 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 99.91 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 99.9 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.87 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.86 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 99.84 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.84 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 99.79 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 99.74 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 99.69 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 99.68 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 99.67 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 99.65 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 99.61 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 99.58 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 99.56 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 99.54 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 99.54 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.53 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 99.48 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 99.4 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.4 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 99.37 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 99.31 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 99.23 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 99.11 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 99.02 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 98.8 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.8 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 98.74 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 98.66 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 98.55 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 98.54 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 98.5 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 98.49 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 98.45 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 98.42 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 98.38 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 98.32 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 98.29 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 98.29 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 98.26 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 98.26 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 98.26 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 98.24 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 98.24 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 98.23 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 98.22 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 98.21 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 98.18 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 98.18 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 98.18 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 98.17 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 98.16 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 98.16 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 98.13 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 98.12 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 98.12 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 98.12 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 98.11 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 98.1 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 98.08 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 98.06 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 98.06 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 98.05 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 98.04 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 98.04 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 98.04 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 98.04 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 98.02 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 98.02 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 98.01 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 98.01 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 98.0 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.97 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 97.96 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 97.96 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 97.96 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.94 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 97.92 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 97.89 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.88 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 97.87 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 97.86 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 97.86 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.84 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 97.8 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 97.8 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 97.78 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 97.77 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 97.73 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 97.66 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 97.59 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 97.54 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 97.52 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 97.44 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 97.43 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 97.4 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 97.38 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 97.38 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.37 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 97.36 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 97.34 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 97.33 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.28 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 97.22 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 97.2 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 97.17 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 97.14 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 97.11 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 97.09 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 97.06 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 97.03 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 97.02 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 97.01 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 96.99 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 96.98 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 96.97 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 96.91 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.91 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 96.9 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.86 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 96.84 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 96.83 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 96.82 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 96.81 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 96.78 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 96.78 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 96.76 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 96.74 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 96.73 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 96.7 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.68 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 96.68 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.64 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 96.63 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 96.58 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 96.57 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 96.56 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 96.53 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.52 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 96.51 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 96.5 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 96.49 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 96.47 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.46 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 96.43 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 96.42 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.38 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.33 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.33 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 96.33 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 96.29 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 96.27 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 96.26 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 96.25 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 96.24 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 96.23 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 96.21 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 96.21 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 96.19 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 96.18 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 96.17 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 96.17 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 96.16 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 96.16 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 96.14 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 96.12 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.11 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 96.1 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 96.1 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 96.09 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 96.07 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 96.07 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.07 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 96.06 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 96.04 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 96.03 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 96.02 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 96.01 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 96.01 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 96.01 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 95.99 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 95.99 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 95.98 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 95.93 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 95.93 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 95.91 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 95.87 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 95.86 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 95.85 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 95.85 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 95.85 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 95.83 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 95.81 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 95.78 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 95.78 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 95.78 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 95.77 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 95.76 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 95.75 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 95.7 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 95.65 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 95.65 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 95.59 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 95.55 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 95.54 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 95.53 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 95.48 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 95.42 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 95.36 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 95.34 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 95.2 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 95.16 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 95.14 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 95.14 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 95.13 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 95.1 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 95.01 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 95.01 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 94.93 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 94.88 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 94.86 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 94.8 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 94.5 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 94.49 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 94.48 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 94.15 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 94.1 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 93.89 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 93.85 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 93.82 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 93.79 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 93.56 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 93.5 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 93.39 | |
| d1j3ba1 | 318 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 93.31 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 93.22 | |
| d2olra1 | 313 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 93.15 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 93.12 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 93.08 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 92.69 | |
| d1ii2a1 | 323 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 92.44 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 92.33 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 92.09 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 91.89 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 91.66 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 91.64 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 91.61 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 91.57 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 91.56 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 91.54 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 91.49 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 91.08 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 90.81 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 90.77 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 90.74 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 90.4 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 89.99 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 89.95 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 89.44 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 89.29 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 88.92 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 88.19 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 88.12 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 87.14 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 87.01 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 86.38 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 86.36 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 86.19 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 85.38 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 83.86 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 83.54 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 83.52 | |
| d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 83.46 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 81.21 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 80.57 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 80.48 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 80.45 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 80.27 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 80.11 |
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: AAA domain of cell division protein FtsH species: Escherichia coli [TaxId: 562]
Probab=99.96 E-value=6.6e-31 Score=207.41 Aligned_cols=172 Identities=23% Similarity=0.340 Sum_probs=135.4
Q ss_pred ceeechhhHHhhheeeeEecccceEeecccceeeeCCcEEEEcCCCCcHHHHHHHHHHHhCCCeEEeccCcccccCccCC
Q psy5910 5 RHIIGQHETKKIVSVGVYNHYKRLFLLKSKNIYLEKSNILLVGPTGCGKTLMVKTLAKIINVPIIVVDATSFTEAGYVGD 84 (225)
Q Consensus 5 ~~i~G~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~vLl~Gp~GtGKT~la~~ia~~~~~~~~~~~~~~~~~~~~~g~ 84 (225)
+.|+|+++++++|.+.+.+ +.+...++..+... ++++||+||||||||++|+++|++++.+++.++++.+.+ .|.|+
T Consensus 12 ~Di~Gl~~~k~~l~e~v~~-~~~~~~~~~~g~~~-~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l~~-~~~g~ 88 (256)
T d1lv7a_ 12 ADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKI-PKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVE-MFVGV 88 (256)
T ss_dssp GGSCSCHHHHHHTHHHHHH-HHCGGGC-----CC-CCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSSTT-SCCCC
T ss_pred HHHhchHHHHHHHHHHHHH-HHCHHHHHHcCCCC-CCeEEeeCCCCCCccHHHHHHHHHcCCCEEEEEhHHhhh-cchhH
Confidence 4679999999999887643 44444455555543 458999999999999999999999999999999999985 69998
Q ss_pred cHHHHHHHHHHhcchhhhhhCCCEEEEcchhhhcccccccC-CCCCChHHHHHHHHHHHhcCCcCccccccccCCCCCCc
Q psy5910 85 DVESIIQKLLHECDYDVELAEQSIIYIDEIDKISKKTDVVS-GKDVSGEGVQQSLLKLIEGVNLSITSLAEKKNPSQNPQ 163 (225)
Q Consensus 85 ~~~~~~~~~~~~~~~~~~~~~~~vl~iDEid~l~~~~~~~~-~~~~~~~~~~~~Ll~~l~~~~~~~~~~~~~~~~~~~~~ 163 (225)
. ...++.+|+.+ ....|+||||||+|.++..++... +......++.+.|+..||+... +.+
T Consensus 89 ~-~~~l~~~f~~A----~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~-------------~~~ 150 (256)
T d1lv7a_ 89 G-ASRVRDMFEQA----KKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEG-------------NEG 150 (256)
T ss_dssp C-HHHHHHHHHHH----HTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCS-------------SSC
T ss_pred H-HHHHHHHHHHH----HHcCCEEEEEEChhhhCccCCCCCCCCcHHHHHHHHHHHHHhhCCCC-------------CCC
Confidence 8 56678888776 567899999999999998875544 2334445677889999986431 122
Q ss_pred eeEEecCcceeeccCccccHHHHHHh--hcccccccccccccc
Q psy5910 164 VFNIDTTNILFIAGGAFSGIENFIIN--RINQETNFLEKLNNN 204 (225)
Q Consensus 164 ~~~i~ttn~~~i~~~~~~~l~~al~~--Rf~~~i~~~~~~~~~ 204 (225)
+++|+|||. ++.||++++| ||+..|.++.|+.++
T Consensus 151 v~vIatTn~-------~~~ld~al~R~gRfd~~i~i~~P~~~~ 186 (256)
T d1lv7a_ 151 IIVIAATNR-------PDVLDPALLRPGRFDRQVVVGLPDVRG 186 (256)
T ss_dssp EEEEEEESC-------TTTSCGGGGSTTSSCEEEECCCCCHHH
T ss_pred EEEEEeCCC-------cccCCHhHcCCCCCCEEEECCCcCHHH
Confidence 899999999 7799999998 999999999999866
|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|