Diaphorina citri psyllid: psy5913

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-

MDINGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNRVEDEDNNNDDHSDGRKSADPKDHLDSKDSGTGSSEDGDRPPNHRLDLLDRPGGAVDTGSEWSESRPDSGPDSPECLFERPHHFLHPAYHGLHHPHARFQSSPPPSHGPGATISPVNVNKPRIWSLADMASKENDIRSSLPSSVFSSGKMISPLAGRPHHLPHPNSYRHDLYRLYGSHLGAHPGSTEFLEQYQRHISSLSSNNANSSPLSSVGAVVAAAAAASSGGGSSTTPFGLAVTAGASSASSSGSSVSESPGLHNNNNNNNNN

ccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccc

***************TSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK**************************************************************************************************************************************WSLAD**************************************YRHDLYRLYGSHLGAH*************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043565 [MF]	sequence-specific DNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003700 [MF]	sequence-specific DNA binding transcription factor activity	probable	GO:0003674, GO:0001071
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007498 [BP]	mesoderm development	probable	GO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0045665 [BP]	negative regulation of neuron differentiation	probable	GO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0045666 [BP]	positive regulation of neuron differentiation	probable	GO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048522
GO:0072086 [BP]	specification of loop of Henle identity	probable	GO:0048598, GO:0016331, GO:0061326, GO:0061004, GO:0009887, GO:0035148, GO:0009790, GO:0072175, GO:0072078, GO:0072079, GO:0035282, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0001822, GO:0072073, GO:0048513, GO:0072070, GO:0048729, GO:0060562, GO:0048646, GO:0032502, GO:0061333, GO:0032501, GO:0035239, GO:0002009, GO:0060429, GO:0009888, GO:0044767, GO:0072009, GO:0008150, GO:0003002, GO:0060993, GO:0072001, GO:0072006, GO:0072048, GO:0001838, GO:0072047, GO:0009954, GO:0044707, GO:0007379, GO:0072028, GO:0048856, GO:0035295, GO:0072081, GO:0072080, GO:0048731, GO:0072088, GO:0001655
GO:0072272 [BP]	proximal/distal pattern formation involved in metanephric nephron development	probable	GO:0061004, GO:0072268, GO:0007275, GO:0044699, GO:0007389, GO:0001822, GO:0048513, GO:0032502, GO:0032501, GO:0072047, GO:0008150, GO:0001655, GO:0001656, GO:0072001, GO:0072006, GO:0072048, GO:0044767, GO:0009954, GO:0044707, GO:0072210, GO:0048856, GO:0048731, GO:0003002
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DMN, chain A
Confidence level:very confident
Coverage over the Query: 4-67
View the alignment between query and template
View the model in PyMOL