Psyllid ID: psy5913

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MDINGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNRVEDEDNNNDDHSDGRKSADPKDHLDSKDSGTGSSEDGDRPPNHRLDLLDRPGGAVDTGSEWSESRPDSGPDSPECLFERPHHFLHPAYHGLHHPHARFQSSPPPSHGPGATISPVNVNKPRIWSLADMASKENDIRSSLPSSVFSSGKMISPLAGRPHHLPHPNSYRHDLYRLYGSHLGAHPGSTEFLEQYQRHISSLSSNNANSSPLSSVGAVVAAAAAASSGGGSSTTPFGLAVTAGASSASSSGSSVSESPGLHNNNNNNNNN
ccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccc
mdingarrknatRETTSTLKAWLNehkknpyptkgEKIMLAIITKMTLTQVSTWFANARRRLKKenkmtweprnrvedednnnddhsdgrksadpkdhldskdsgtgssedgdrppnhrldlldrpggavdtgsewsesrpdsgpdspeclferphhflhpayhglhhpharfqsspppshgpgatispvnvnkpriwsladmaskendirsslpssvfssgkmisplagrphhlphpnsyrhdlyrlygshlgahpgstEFLEQYQRHISSlssnnanssplsSVGAVVAAAAAassgggssttpfgLAVTagassasssgssvsespglhnnnnnnnnn
mdingarrknatretTSTLKAwlnehkknpyptkGEKIMLAIITKMTLTQVSTWFANARrrlkkenkmtweprnrvedednnnddhsdgrksadpkdhldskdsgtgssedgdrppnhrldlldrpggaVDTGSEWSESRPDSGPDSPECLFERPHHFLHPAYHGLHHPHARFQSSPPPSHGPGATISPVNVNKPRIWSLADMASKENDIRSSLPSSVFSSGKMISPLAGRPHHLPHPNSYRHDLYRLYGSHLGAHPGSTEFLEQYQRHISSLSSNNANSSPLSSVGAVVAAAAAASSGGGSSTTPFGLAVTAGASSASSSgssvsespglhnnnnnnnnn
MDINGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPrnrvedednnnddHSDGRKSADPKDHLDSKDSGTGSSEDGDRPPNHRLDLLDRPGGAVDTGSEWSESRPDSGPDSPECLFERPHHFLHPAYHGLHHPHARFQSSPPPSHGPGATISPVNVNKPRIWSLADMASKENDIRSSLPSSVFSSGKMISPLAGRPHHLPHPNSYRHDLYRLYGSHLGAHPGSTEFLEQYQRHIsslssnnanssplssvgavvaaaaaassgggssTTPFGLAVTagassasssgssvsespgLHnnnnnnnnn
*********************W**********TKGEKIMLAIITKMTLTQVSTWFANAR*******************************************************************************************LFERPHHFLHPAYHGL**************************************************************************YRHDLYRLYGSHLGAH*************************************************************************************
***************TSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK**************************************************************************************************************************************WSLAD*******************************************************************************************************************************************
**************TTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNRVE************************************RPPNHRLDLLDRPGG*******************PECLFERPHHFLHPAYHGLHHPHAR**********PGATISPVNVNKPRIWSLADMASKENDIRSSLPSSVFSSGKMISPLAGRPHHLPHPNSYRHDLYRLYGSHLGAHPGSTEFLEQYQRHISSLSSNNANSSPLSSVGAV**************TTPFGLAV*******************LHNNNNNNNNN
***********T*ETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWE*************************************************************************************************************************NKPRIW*L*DMAS*************************RPHHLPHPNSYRHDLYRLYGSHLGAHPGSTEFLEQYQRHISSLSSNNANSSPLSSVGAVVA**************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDINGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNRVEDEDNNNDDHSDGRKSADPKDHLDSKDSGTGSSEDGDRPPNHRLDLLDRPGGAVDTGSEWSESRPDSGPDSPECLFERPHHFLHPAYHGLHHPHARFQSSPPPSHGPGATISPVNVNKPRIWSLADMASKENDIRSSLPSSVFSSGKMISPLAGRPHHLPHPNSYRHDLYRLYGSHLGAHPGSTEFLEQYQRHISSLSSNNANSSPLSSVGAVVAAAAAASSGGGSSTTPFGLAVTAGASSASSSGSSVSESPGLHNNNNNNNNN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query341 2.2.26 [Sep-21-2011]
Q4LDQ3482 Iroquois-class homeodomai yes N/A 0.395 0.280 0.615 2e-36
Q24248 717 Homeobox protein araucan no N/A 0.548 0.260 0.446 3e-36
P78412446 Iroquois-class homeodomai yes N/A 0.304 0.233 0.691 3e-36
P54269 693 Homeobox protein caupolic no N/A 0.351 0.173 0.613 3e-36
P78413519 Iroquois-class homeodomai no N/A 0.228 0.150 0.886 1e-35
Q9QY61515 Iroquois-class homeodomai yes N/A 0.222 0.147 0.894 1e-35
Q9JKQ4484 Iroquois-class homeodomai no N/A 0.595 0.419 0.443 2e-35
Q90XW5474 Iroquois-class homeodomai N/A N/A 0.604 0.434 0.392 2e-35
Q9YGS0485 Iroquois-class homeodomai yes N/A 0.228 0.160 0.886 3e-35
B7ZRT8495 Iroquois-class homeodomai N/A N/A 0.313 0.216 0.630 6e-35
>sp|Q4LDQ3|IRX5_XENTR Iroquois-class homeodomain protein irx-5 OS=Xenopus tropicalis GN=irx5 PE=2 SV=1 Back     alignment and function desciption
 Score =  153 bits (387), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 85/138 (61%), Positives = 101/138 (73%), Gaps = 3/138 (2%)

Query: 6   ARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 65
           A RKNATR+ T+TLKAWLNEH+KNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE
Sbjct: 111 AYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKE 170

Query: 66  NKMTWEPRNRVEDEDNNNDDHSDGRKSADPKDHLDSKDSGTGSSEDGDRPPNHRLDLLDR 125
           NKMTW PRNR EDE+++ +   +  +  DP+  L+ K    G + D  R P+  +D  DR
Sbjct: 171 NKMTWTPRNRSEDEEDDENIDLEKNEEDDPR-KLEEKGDQDGDAGDQKRSPS-AVD-FDR 227

Query: 126 PGGAVDTGSEWSESRPDS 143
             G V  G E  ++R DS
Sbjct: 228 LEGEVRQGKELDQTRSDS 245
Acts partially redundantly with other irx members in neural patterning. Required for formation of the posterior forebrain, midbrain, hindbrain, and to a lesser extent, spinal cord. Patterns the neuroectoderm in both the anterior/posterior and dorsal/ventral axes. Does not appear to play a role in pronephros kidney development.
Xenopus tropicalis (taxid: 8364)
>sp|Q24248|ARA_DROME Homeobox protein araucan OS=Drosophila melanogaster GN=ara PE=1 SV=2 Back     alignment and function description
>sp|P78412|IRX6_HUMAN Iroquois-class homeodomain protein IRX-6 OS=Homo sapiens GN=IRX6 PE=2 SV=3 Back     alignment and function description
>sp|P54269|CAUP_DROME Homeobox protein caupolican OS=Drosophila melanogaster GN=caup PE=2 SV=2 Back     alignment and function description
>sp|P78413|IRX4_HUMAN Iroquois-class homeodomain protein IRX-4 OS=Homo sapiens GN=IRX4 PE=2 SV=2 Back     alignment and function description
>sp|Q9QY61|IRX4_MOUSE Iroquois-class homeodomain protein IRX-4 OS=Mus musculus GN=Irx4 PE=2 SV=1 Back     alignment and function description
>sp|Q9JKQ4|IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 OS=Mus musculus GN=Irx5 PE=2 SV=1 Back     alignment and function description
>sp|Q90XW5|IRX5_XENLA Iroquois-class homeodomain protein irx-5 OS=Xenopus laevis GN=irx5 PE=2 SV=1 Back     alignment and function description
>sp|Q9YGS0|IRX4_CHICK Iroquois-class homeodomain protein IRX-4 OS=Gallus gallus GN=IRX4 PE=2 SV=1 Back     alignment and function description
>sp|B7ZRT8|IRX4B_XENLA Iroquois-class homeodomain protein irx-4-B OS=Xenopus laevis GN=irx4-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
242023070362 Iroquois-class homeodomain protein IRX-1 0.750 0.707 0.669 3e-80
340716066 612 PREDICTED: homeobox protein araucan-like 0.862 0.480 0.56 9e-77
350404409 768 PREDICTED: hypothetical protein LOC10074 0.862 0.382 0.562 1e-76
383860303 685 PREDICTED: uncharacterized protein LOC10 0.791 0.394 0.598 5e-75
380014060 620 PREDICTED: homeobox protein araucan-like 0.788 0.433 0.575 6e-75
328777967 622 PREDICTED: homeobox protein araucan [Api 0.794 0.435 0.578 8e-75
332024324 625 Homeobox protein caupolican [Acromyrmex 0.780 0.425 0.556 8e-74
307177870416 Homeobox protein araucan [Camponotus flo 0.777 0.637 0.573 1e-72
157116233 540 iroquois-class homeodomain protein irx [ 0.885 0.559 0.552 2e-72
170027824 512 iroquois-class homeodomain protein irx [ 0.876 0.583 0.551 2e-71
>gi|242023070|ref|XP_002431959.1| Iroquois-class homeodomain protein IRX-1, putative [Pediculus humanus corporis] gi|212517310|gb|EEB19221.1| Iroquois-class homeodomain protein IRX-1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  305 bits (780), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 190/284 (66%), Positives = 207/284 (72%), Gaps = 28/284 (9%)

Query: 1   MDINGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARR 60
           MD+NGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARR
Sbjct: 1   MDLNGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARR 60

Query: 61  RLKKENKMTWEPRNRVEDEDNNNDDHSDGRKSADPKDHLDSKDSGTGSSEDGDRPPNHRL 120
           RLKKENKMTWEPRNRVE+EDNNN+    GRKSAD     DSKDSGTGSSE+G+R PNHR+
Sbjct: 61  RLKKENKMTWEPRNRVEEEDNNNE--ESGRKSADNGKDPDSKDSGTGSSENGER-PNHRM 117

Query: 121 DLLDRPGGAVDTGSEWSESRPDSGPDSPECLFERPHHFLHPAYHGLHHPHARFQSSPPPS 180
           +LLDRP G VDT SEWSESR DSGPDSPECLFER    LHPAY  L HP +R        
Sbjct: 118 ELLDRPCGPVDTASEWSESRADSGPDSPECLFERQQQLLHPAYQHLQHPASRLHVP---- 173

Query: 181 HGPGATISPVNVNKPRIWSLADMASKENDIRSSLPS--SVF---SSGKMISPL---AGRP 232
               ++ SP    KPRIWSLADMASKENDI SS PS  S F   ++GK+ISPL   A  P
Sbjct: 174 ----SSSSPSGPPKPRIWSLADMASKENDIHSS-PSTTSAFYATAAGKLISPLSRGAMPP 228

Query: 233 HHL---PHPNSYRHDLYR-LYG--SHLG--AHPGSTEFLEQYQR 268
             +    +P    H+ YR LYG  +HL   A   S   LE Y R
Sbjct: 229 LSVPPGSYPRPPPHEFYRSLYGPAAHLAGSAASESVSLLETYSR 272

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340716066|ref|XP_003396524.1| PREDICTED: homeobox protein araucan-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350404409|ref|XP_003487095.1| PREDICTED: hypothetical protein LOC100743699 [Bombus impatiens] Back     alignment and taxonomy information
>gi|383860303|ref|XP_003705630.1| PREDICTED: uncharacterized protein LOC100877027 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380014060|ref|XP_003691061.1| PREDICTED: homeobox protein araucan-like [Apis florea] Back     alignment and taxonomy information
>gi|328777967|ref|XP_396291.3| PREDICTED: homeobox protein araucan [Apis mellifera] Back     alignment and taxonomy information
>gi|332024324|gb|EGI64523.1| Homeobox protein caupolican [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307177870|gb|EFN66830.1| Homeobox protein araucan [Camponotus floridanus] Back     alignment and taxonomy information
>gi|157116233|ref|XP_001658394.1| iroquois-class homeodomain protein irx [Aedes aegypti] gi|108876563|gb|EAT40788.1| AAEL007502-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170027824|ref|XP_001841797.1| iroquois-class homeodomain protein irx [Culex quinquefasciatus] gi|167862367|gb|EDS25750.1| iroquois-class homeodomain protein irx [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
FB|FBgn0014343641 mirr "mirror" [Drosophila mela 0.513 0.273 0.621 2e-53
UNIPROTKB|Q4LDQ3482 irx5 "Iroquois-class homeodoma 0.413 0.292 0.555 2.5e-41
UNIPROTKB|Q9YGS0485 IRX4 "Iroquois-class homeodoma 0.319 0.224 0.633 8.3e-40
UNIPROTKB|F1RF01500 IRX3 "Uncharacterized protein" 0.278 0.19 0.690 3.8e-39
UNIPROTKB|F1RF02440 IRX6 "Uncharacterized protein" 0.211 0.163 0.904 3.5e-38
UNIPROTKB|A2VDX5502 IRX3 "IRX3 protein" [Bos tauru 0.278 0.189 0.690 6e-38
FB|FBgn0015919 693 caup "caupolican" [Drosophila 0.472 0.232 0.5 9.1e-38
UNIPROTKB|P78415501 IRX3 "Iroquois-class homeodoma 0.369 0.251 0.525 9.9e-38
RGD|1307424505 Irx3 "iroquois homeobox 3" [Ra 0.196 0.132 0.925 1.3e-37
MGI|MGI:1197522507 Irx3 "Iroquois related homeobo 0.196 0.132 0.925 9.3e-37
FB|FBgn0014343 mirr "mirror" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 531 (192.0 bits), Expect = 2.0e-53, Sum P(2) = 2.0e-53
 Identities = 115/185 (62%), Positives = 130/185 (70%)

Query:     1 MDINGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARR 60
             MD+NGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARR
Sbjct:   221 MDLNGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARR 280

Query:    61 RLKKENKMTWEPXXXXXXXXXXXXXHSDGRKSADPKDHLDSKDSGTGSSEDGDRPPNHRL 120
             RLKKENKMTWEP               D  K+ +  D LD+KDSG GS++D DR  + RL
Sbjct:   281 RLKKENKMTWEPRNRVDDDDANIDDDDD--KNTEDNDLLDAKDSGVGSTDDKDR--SGRL 336

Query:   121 -DLL-DRPGGAVDTGSEWSESRPDSGPDSPECLFERPHHFLHPAYHGLHHPHARFQSSPP 178
              D++ DRPG +    SEWSESRP S   SP+ L++RP   + P  H L HP A      P
Sbjct:   337 GDMMTDRPGES--NNSEWSESRPGSPNGSPD-LYDRPGS-MPPGAHPLFHPAALHHHFRP 392

Query:   179 PSHGP 183
             P+  P
Sbjct:   393 PAGSP 397
GO:0045317 "equator specification" evidence=IMP;TAS
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=ISS
GO:0000981 "sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=ISS;IDA
GO:0001700 "embryonic development via the syncytial blastoderm" evidence=IEP;IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0007422 "peripheral nervous system development" evidence=IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0001745 "compound eye morphogenesis" evidence=IMP
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0007224 "smoothened signaling pathway" evidence=IGI
GO:0046843 "dorsal appendage formation" evidence=IMP
GO:0042803 "protein homodimerization activity" evidence=IPI
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0097374 "sensory neuron axon guidance" evidence=IMP
UNIPROTKB|Q4LDQ3 irx5 "Iroquois-class homeodomain protein irx-5" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q9YGS0 IRX4 "Iroquois-class homeodomain protein IRX-4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RF01 IRX3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RF02 IRX6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A2VDX5 IRX3 "IRX3 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0015919 caup "caupolican" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P78415 IRX3 "Iroquois-class homeodomain protein IRX-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1307424 Irx3 "iroquois homeobox 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1197522 Irx3 "Iroquois related homeobox 3 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 7e-17
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 4e-14
smart0038957 smart00389, HOX, Homeodomain 3e-12
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-07
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 2e-05
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information 
 Score = 72.9 bits (180), Expect = 7e-17
 Identities = 21/40 (52%), Positives = 26/40 (65%)

Query: 22 WLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR 61
          WL EH  NPYP++ EK  LA  T ++  Q+  WF NARRR
Sbjct: 1  WLLEHLHNPYPSEEEKSELARQTGLSRKQIDNWFINARRR 40

This is a homeobox transcription factor KN domain conserved from fungi to human and plants. Length = 40
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 341
KOG0489|consensus261 99.76
KOG0488|consensus309 99.71
KOG0843|consensus197 99.7
KOG0850|consensus245 99.64
KOG0487|consensus308 99.63
KOG0842|consensus307 99.63
KOG0484|consensus125 99.6
KOG0485|consensus268 99.59
KOG2251|consensus228 99.53
KOG0494|consensus332 99.53
KOG0492|consensus246 99.51
KOG0847|consensus288 99.48
KOG0491|consensus194 99.46
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.46
KOG0848|consensus317 99.46
KOG0493|consensus342 99.37
KOG4577|consensus383 99.35
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.33
KOG0844|consensus408 99.31
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.31
KOG0483|consensus198 99.28
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.27
COG5576156 Homeodomain-containing transcription factor [Trans 99.24
KOG0486|consensus351 99.2
KOG3802|consensus398 99.13
KOG0490|consensus235 99.08
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.9
KOG0849|consensus354 98.87
KOG0775|consensus304 98.84
KOG0774|consensus334 98.76
smart0054826 IRO Motif in Iroquois-class homeodomain proteins ( 98.68
KOG0773|consensus342 98.32
KOG1168|consensus385 98.14
KOG2252|consensus558 97.76
KOG0490|consensus235 97.68
KOG1146|consensus 1406 96.89
KOG0773|consensus342 96.86
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 94.61
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 87.17
KOG3623|consensus 1007 84.09
>KOG0489|consensus Back     alignment and domain information 
Probab=99.76  E-value=7.7e-19  Score=166.87  Aligned_cols=68  Identities=31%  Similarity=0.399  Sum_probs=63.5

Q ss_pred             CCCCCCCCCcccHHHHHHHHHHHhcCCCCCHHHHHHHHHHhCCCccccccchhhhHHHHhhhhcccCC
Q psy5913           4 NGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWE   71 (341)
Q Consensus         4 ~~krRR~Rt~fS~~QL~~Le~~F~~npYPs~~eR~~LA~~lgLsesQVkvWFQNRR~K~KK~~k~~~~   71 (341)
                      .++.||.||.||..||.+||++|+.|+|+++..|+++|..|+|+++|||||||||||||||.++....
T Consensus       156 ~~~~kR~RtayT~~QllELEkEFhfN~YLtR~RRiEiA~~L~LtErQIKIWFQNRRMK~Kk~~k~~~~  223 (261)
T KOG0489|consen  156 GGKSKRRRTAFTRYQLLELEKEFHFNKYLTRSRRIEIAHALNLTERQIKIWFQNRRMKWKKENKAKSS  223 (261)
T ss_pred             cCCCCCCCcccchhhhhhhhhhhccccccchHHHHHHHhhcchhHHHHHHHHHHHHHHHHHhhccccc
Confidence            46789999999999999999999999999999999999999999999999999999999998776443

>KOG0488|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>smart00548 IRO Motif in Iroquois-class homeodomain proteins (only) Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
1x2n_A73 Solution Structure Of The Homeobox Domain Of Human 5e-08
2lk2_A89 Solution Nmr Structure Of Homeobox Domain (171-248) 9e-08
2dmn_A83 The Solution Structure Of The Homeobox Domain Of Hu 1e-07
1lfu_P82 Nmr Solution Stucture Of The Extended Pbx Homeodoma 1e-06
1puf_B73 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 2e-06
3k2a_A67 Crystal Structure Of The Homeobox Domain Of Human H 2e-06
1b72_B87 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 3e-06
1b8i_B63 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 9e-06
1du6_A64 Solution Structure Of The Truncated Pbx Homeodomain 2e-04
>pdb|1X2N|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Pknox1 Length = 73 Back     alignment and structure 
Iteration: 1

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%)
Query: 13 RETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRL 62
          +  T+ +++WL +H  +PYPT+ EK  +A  T +TL QV+ WF NARRR+
Sbjct: 16 KHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRI 65
>pdb|2LK2|A Chain A, Solution Nmr Structure Of Homeobox Domain (171-248) Of Human Homeobox Protein Tgif1, Northeast Structural Genomics Consortium Target Hr4411b Length = 89 Back     alignment and structure
>pdb|2DMN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Tgif2lx Length = 83 Back     alignment and structure
>pdb|1LFU|P Chain P, Nmr Solution Stucture Of The Extended Pbx Homeodomain Bound To Dna Length = 82 Back     alignment and structure
>pdb|1PUF|B Chain B, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 73 Back     alignment and structure
>pdb|3K2A|A Chain A, Crystal Structure Of The Homeobox Domain Of Human Homeobox Protein Meis2 Length = 67 Back     alignment and structure
>pdb|1B72|B Chain B, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 87 Back     alignment and structure
>pdb|1B8I|B Chain B, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 63 Back     alignment and structure
>pdb|1DU6|A Chain A, Solution Structure Of The Truncated Pbx Homeodomain Length = 64 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 4e-28
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 1e-25
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 1e-25
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 2e-25
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 2e-25
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 5e-25
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 3e-23
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 3e-23
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 1e-22
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 2e-22
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 3e-10
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 3e-10
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-09
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 4e-09
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 5e-09
2xsd_C164 POU domain, class 3, transcription factor 1; trans 6e-07
1e3o_C160 Octamer-binding transcription factor 1; transcript 7e-07
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-06
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 3e-06
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 8e-06
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 9e-06
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 9e-06
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-05
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-05
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 1e-05
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-05
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-05
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-05
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 4e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 5e-05
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 5e-05
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 5e-05
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 8e-05
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 8e-05
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 1e-04
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 2e-04
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-04
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-04
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 2e-04
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 3e-04
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-04
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 5e-04
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 8e-04
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
 Score =  103 bits (258), Expect = 4e-28
 Identities = 25/69 (36%), Positives = 35/69 (50%)

Query: 7  RRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKEN 66
          +R+N  ++ T  L  +   H  NPYP++  K  LA    +T++QVS WF N R R KK  
Sbjct: 4  KRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNI 63

Query: 67 KMTWEPRNR 75
              E  N 
Sbjct: 64 GKFQEEANI 72
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.71
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.7
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.7
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.7
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.69
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.69
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.69
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.69
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.69
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.69
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.69
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.69
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.69
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.69
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.69
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.68
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.68
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.68
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.68
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.68
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.68
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.68
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.68
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.68
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.68
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.67
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.67
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.67
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.67
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.67
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.66
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.65
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.65
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.65
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.65
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.65
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.64
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.64
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.64
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.64
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.64
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.63
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.63
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.63
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.63
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.63
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.63
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.63
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.62
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.61
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.61
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.6
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.59
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.59
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.59
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.58
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.58
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.58
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.58
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.57
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.57
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.56
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.56
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.56
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.56
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.55
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.51
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.51
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.51
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.49
2e19_A64 Transcription factor 8; homeobox domain, structura 99.48
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.47
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.38
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.32
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.18
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.17
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.07
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.47
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 90.86
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.71  E-value=5.6e-18  Score=132.40  Aligned_cols=64  Identities=27%  Similarity=0.325  Sum_probs=60.3

Q ss_pred             CCCCCCCCCcccHHHHHHHHHHHhcCCCCCHHHHHHHHHHhCCCccccccchhhhHHHHhhhhc
Q psy5913           4 NGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENK   67 (341)
Q Consensus         4 ~~krRR~Rt~fS~~QL~~Le~~F~~npYPs~~eR~~LA~~lgLsesQVkvWFQNRR~K~KK~~k   67 (341)
                      .+++||.|+.|+..||..|+..|..++||+..+|..||..++|++.||+|||||||+|+||..+
T Consensus        14 ~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~L~~~qV~vWFqNRR~k~kk~~~   77 (80)
T 2dmt_A           14 AKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKSGP   77 (80)
T ss_dssp             CCCCCCSCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHSCCCS
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCHHHeeeccHHHHHHhhcccC
Confidence            4567889999999999999999999999999999999999999999999999999999998754
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 341
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 4e-20
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-18
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 3e-17
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 2e-13
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-12
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-11
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-11
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 2e-11
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 4e-11
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 4e-11
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 6e-10
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 6e-10
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-09
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-09
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 4e-09
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 6e-09
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 9e-09
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 1e-08
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-08
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 3e-08
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-08
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 5e-08
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 5e-08
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 5e-08
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 2e-07
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 3e-07
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 1e-06
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 1e-06
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 2e-06
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 3e-05
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 4e-05
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 7e-05
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 80.5 bits (199), Expect = 4e-20
 Identities = 24/58 (41%), Positives = 38/58 (65%)

Query: 7  RRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKK 64
          +R    +  T+ +++WL +H  +PYPT+ EK  +A  T +TL QV+ WF NARRR+ +
Sbjct: 5  KRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQ 62
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.72
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.71
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.71
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.7
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.7
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.7
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.7
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.7
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.69
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.67
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.67
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.67
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.67
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.66
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.64
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.64
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.61
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.61
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.61
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.59
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.57
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.57
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.56
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.52
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.51
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.48
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.46
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.43
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.42
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.42
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.33
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.72  E-value=1e-18  Score=128.57  Aligned_cols=58  Identities=26%  Similarity=0.385  Sum_probs=55.4

Q ss_pred             CCCCCCcccHHHHHHHHHHHhcCCCCCHHHHHHHHHHhCCCccccccchhhhHHHHhh
Q psy5913           7 RRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKK   64 (341)
Q Consensus         7 rRR~Rt~fS~~QL~~Le~~F~~npYPs~~eR~~LA~~lgLsesQVkvWFQNRR~K~KK   64 (341)
                      +||.|+.|+..|+..|+..|..++||+..+|+.||..+||++.||+|||||||+|+||
T Consensus         1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            3667899999999999999999999999999999999999999999999999999986
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure