Diaphorina citri psyllid: psy5915


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
REQIRPGRESNPRPSAYKADALPTKPTRLGLTALSSDVLSRDCVFEVDKERGLTLIEIAEGVEVPEIIVSTGCDFAVSPDLKPMGQVET
ccccccccccccccccccccccccccccccccccccEEEcccEEEEEcccccEEEEEEcccccHHHHHHHccccEEEcccccccccccc
****************YKADALPTKPTRLGLTALSSDVLSRDCVFEVDKERGLTLIEIAEGVEVPEIIVSTGCDFAVSPDLKPMG****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
REQIRPGRESNPRPSAYKADALPTKPTRLGLTALSSDVLSRDCVFEVDKERGLTLIEIAEGVEVPEIIVSTGCDFAVSPDLKPMGQVET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.confidentB2GV06
Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.confidentP55809
Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.confidentQ29551

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0046950 [BP]cellular ketone body metabolic processprobableGO:0044710, GO:0009987, GO:0044237, GO:0008150, GO:0044281, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K6M, chain A
Confidence level:very confident
Coverage over the Query: 19-88
View the alignment between query and template
View the model in PyMOL