Diaphorina citri psyllid: psy592


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MENILNIVTITYLYDLANPGLHKNSVPGCPATEAVCNAHSRLHCYPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHNREYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAVAVNDGQWHFVKTGSALFVTLLISPNQVLVLVFVVYSRRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPHPEMNNKIPYGLGPMPMGVEPNVGIFIEEHKKRADADPNAPPFDDLRNYAYEGGGSTAGSLSSLASGSSIKNN
cccccEEEEccEEccccccccccccccccccccccccccccccccccccEEccccccEEEEccccccccccccccccCECccccEEEEEccccccccccEEEEEEEcccccEEEEEEEccccccEEEEEEEcccEEEEEEccccccccccccccEEccccEEEEEEEcccccccccEEcccEEEccccccEEEccccEEEEEEEcccHHHEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccEEEccccccccccccccccccccccccc
*ENILNIVTITYLYDLANPGLH**SVPGCPATEAVCNAHSRLHCYPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHNREYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAVAVNDGQWHFVKTGSALFVTLLISPNQVLVLVFVVYSRRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIG*********IPYGLGPMPMGVEPNVGIFIEEHKKRADADPNAPPFDDLRNYAYEGGGST****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENILNIVTITYLYDLANPGLHKNSVPGCPATEAVCNAHSRLHCYPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHNREYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAVAVNDGQWHFVKTGSALFVTLLISPNQVLVLVFVVYSRRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPHPEMNNKIPYGLGPMPMGVEPNVGIFIEEHKKRADADPNAPPFDDLRNYAYEGGGSTAGSLSSLASGSSIKNN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Neural-cadherin Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. May associate with arm neural isoform and participate in the transmission of developmental information.confidentO15943

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0044331 [BP]cell-cell adhesion mediated by cadherinprobableGO:0016337, GO:0009987, GO:0044763, GO:0044699, GO:0007155, GO:0008150, GO:0022610, GO:0033631, GO:0033627

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QCW, chain A
Confidence level:very confident
Coverage over the Query: 1-162
View the alignment between query and template
View the model in PyMOL
Template: 1I7W, chain B
Confidence level:very confident
Coverage over the Query: 297-318
View the alignment between query and template
View the model in PyMOL
Template: 1Q55, chain A
Confidence level:very confident
Coverage over the Query: 176-189
View the alignment between query and template
View the model in PyMOL