Psyllid ID: psy592
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 339 | ||||||
| 345493993 | 3062 | PREDICTED: LOW QUALITY PROTEIN: neural-c | 0.507 | 0.056 | 0.586 | 1e-61 | |
| 110764123 | 3043 | PREDICTED: neural-cadherin [Apis mellife | 0.507 | 0.056 | 0.586 | 8e-61 | |
| 307174406 | 1686 | Neural-cadherin [Camponotus floridanus] | 0.507 | 0.102 | 0.581 | 4e-60 | |
| 350418529 | 3006 | PREDICTED: neural-cadherin-like [Bombus | 0.507 | 0.057 | 0.581 | 4e-60 | |
| 340722540 | 3006 | PREDICTED: neural-cadherin-like [Bombus | 0.507 | 0.057 | 0.581 | 5e-60 | |
| 307200809 | 1625 | Neural-cadherin [Harpegnathos saltator] | 0.507 | 0.105 | 0.586 | 9e-60 | |
| 322793232 | 1797 | hypothetical protein SINV_09531 [Solenop | 0.507 | 0.095 | 0.581 | 9e-60 | |
| 383864729 | 1849 | PREDICTED: neural-cadherin-like [Megachi | 0.507 | 0.093 | 0.581 | 3e-59 | |
| 189237687 | 3035 | PREDICTED: similar to Neural-cadherin pr | 0.510 | 0.057 | 0.554 | 2e-58 | |
| 158298606 | 1698 | AGAP009726-PA [Anopheles gambiae str. PE | 0.510 | 0.101 | 0.559 | 5e-58 |
| >gi|345493993|ref|XP_003427197.1| PREDICTED: LOW QUALITY PROTEIN: neural-cadherin-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 243 bits (619), Expect = 1e-61, Method: Compositional matrix adjust.
Identities = 119/203 (58%), Positives = 142/203 (69%), Gaps = 31/203 (15%)
Query: 4 ILNIVTITYLYDLANPGLHKNSVPGCPATEAVCN-AHSRLHCYPEHGVCVGSMHTAKCQC 62
I N+ + LYDLA+PGL +NSV GCP TE +CN S C+ EHG CVGS A+CQC
Sbjct: 2518 IKNLFHNSKLYDLAHPGLSRNSVAGCPQTEEICNNQESTTRCW-EHGTCVGSFSEARCQC 2576
Query: 63 LPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHN 122
PGW+G GC+TPT P TFKPQSY+KYALSFEPDKY+TQ+QL+FRTRE GELFR+SDQHN
Sbjct: 2577 NPGWTGPGCMTPTIPTTFKPQSYVKYALSFEPDKYSTQIQLRFRTREVHGELFRVSDQHN 2636
Query: 123 REYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAV 182
REYA+LEIKDS+LRFRYNLNN++T+E+DIWL AI
Sbjct: 2637 REYAVLEIKDSRLRFRYNLNNMRTEERDIWLTAI-------------------------- 2670
Query: 183 AVNDGQWHFVKT---GSALFVTL 202
AV+DGQWH V+ GSA + L
Sbjct: 2671 AVDDGQWHTVRVSRYGSAATLEL 2693
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|110764123|ref|XP_392099.3| PREDICTED: neural-cadherin [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307174406|gb|EFN64925.1| Neural-cadherin [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|350418529|ref|XP_003491887.1| PREDICTED: neural-cadherin-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340722540|ref|XP_003399662.1| PREDICTED: neural-cadherin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307200809|gb|EFN80862.1| Neural-cadherin [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322793232|gb|EFZ16889.1| hypothetical protein SINV_09531 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383864729|ref|XP_003707830.1| PREDICTED: neural-cadherin-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|189237687|ref|XP_969192.2| PREDICTED: similar to Neural-cadherin precursor (Cadherin-N protein) (DN-cadherin) [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|158298606|ref|XP_001238044.2| AGAP009726-PA [Anopheles gambiae str. PEST] gi|157013965|gb|EAU76028.2| AGAP009726-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 339 | ||||||
| FB|FBgn0015609 | 3097 | CadN "Cadherin-N" [Drosophila | 0.448 | 0.049 | 0.655 | 8.6e-92 | |
| FB|FBgn0262018 | 2215 | CadN2 "Cadherin-N2" [Drosophil | 0.448 | 0.068 | 0.564 | 1.6e-66 | |
| ZFIN|ZDB-GENE-100922-84 | 2780 | si:dkey-22o22.2 "si:dkey-22o22 | 0.404 | 0.049 | 0.326 | 1.9e-19 | |
| UNIPROTKB|F1NHQ1 | 2501 | LOC427547 "Uncharacterized pro | 0.383 | 0.051 | 0.312 | 1.7e-18 | |
| UNIPROTKB|F1NBM7 | 2449 | LOC414835 "Uncharacterized pro | 0.404 | 0.055 | 0.311 | 8.5e-18 | |
| UNIPROTKB|F1P3P7 | 2530 | LOC414835 "Uncharacterized pro | 0.404 | 0.054 | 0.304 | 3.7e-17 | |
| UNIPROTKB|F1NHQ5 | 2500 | LOC427547 "Uncharacterized pro | 0.383 | 0.052 | 0.312 | 3.8e-17 | |
| UNIPROTKB|F1NJK1 | 2537 | LOC427547 "Uncharacterized pro | 0.383 | 0.051 | 0.312 | 3.3e-16 | |
| ZFIN|ZDB-GENE-980526-170 | 800 | cdh11 "cadherin 11, osteoblast | 0.587 | 0.248 | 0.274 | 7.4e-10 | |
| UNIPROTKB|K7GLK6 | 670 | CDH11 "Uncharacterized protein | 0.483 | 0.244 | 0.299 | 7.9e-09 |
| FB|FBgn0015609 CadN "Cadherin-N" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 556 (200.8 bits), Expect = 8.6e-92, Sum P(2) = 8.6e-92
Identities = 101/154 (65%), Positives = 122/154 (79%)
Query: 4 ILNIVTITYLYDLANPGLHKNSVPGCPATEAVC-NAHSRLHCYPEHGVCVGSMHTAKCQC 62
I N+V + LYDLA+PGL +NSV GCP TE VC + C+ EHG CVGS+ A+C C
Sbjct: 2560 IRNLVHNSKLYDLAHPGLSRNSVAGCPQTEEVCAQTETTARCW-EHGNCVGSLSEARCHC 2618
Query: 63 LPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHN 122
PGW+G C PT P TFK QSY+KYALSFEPD+++TQ+QL+FRTREE+GELFR+SDQHN
Sbjct: 2619 RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFSTQVQLRFRTREEYGELFRVSDQHN 2678
Query: 123 REYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAI 156
REY ILEIKD L FRYNLN+L+T+EKD+WLNAI
Sbjct: 2679 REYGILEIKDGHLHFRYNLNSLRTEEKDLWLNAI 2712
|
|
| FB|FBgn0262018 CadN2 "Cadherin-N2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-100922-84 si:dkey-22o22.2 "si:dkey-22o22.2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHQ1 LOC427547 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NBM7 LOC414835 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3P7 LOC414835 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHQ5 LOC427547 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NJK1 LOC427547 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-980526-170 cdh11 "cadherin 11, osteoblast" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GLK6 CDH11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 339 | |||
| pfam01049 | 145 | pfam01049, Cadherin_C, Cadherin cytoplasmic region | 1e-50 | |
| cd00110 | 151 | cd00110, LamG, Laminin G domain; Laminin G-like do | 2e-11 | |
| pfam02210 | 124 | pfam02210, Laminin_G_2, Laminin G domain | 7e-08 | |
| smart00282 | 132 | smart00282, LamG, Laminin G domain | 1e-07 |
| >gnl|CDD|216265 pfam01049, Cadherin_C, Cadherin cytoplasmic region | Back alignment and domain information |
|---|
Score = 164 bits (418), Expect = 1e-50
Identities = 59/121 (48%), Positives = 71/121 (58%), Gaps = 6/121 (4%)
Query: 219 RRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGP----HPEMNNKI 274
RRR+ +DD+RENIINYDDEGGGE+D A+DI+ L+ P+ P ++
Sbjct: 1 RRRKKEPLIIDKEDDIRENIINYDDEGGGEEDTDAYDISALRNPLDPLRRDVQPLISALP 60
Query: 275 PYGLGPMPMGVEPNVGIFIEEHKKRADADPNAPPFDDLRNYAYEGGGSTAGSLSSLASGS 334
P P +VG FI E AD DP APP+D L YAYEG GS AGSLSSL S S
Sbjct: 61 RPRPPPPPDP--GDVGDFIHEKLPEADNDPTAPPYDSLLTYAYEGRGSVAGSLSSLNSSS 118
Query: 335 S 335
S
Sbjct: 119 S 119
|
Cadherins are vital in cell-cell adhesion during tissue differentiation. Cadherins are linked to the cytoskeleton by catenins. Catenins bind to the cytoplasmic tail of the cadherin. Cadherins cluster to form foci of homophilic binding units. A key determinant to the strength of the binding that it is mediated by cadherins is the juxtamembrane region of the cadherin. This region induces clustering and also binds to the protein p120ctn. Length = 145 |
| >gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|214598 smart00282, LamG, Laminin G domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 339 | |||
| PF01049 | 149 | Cadherin_C: Cadherin cytoplasmic region; InterPro: | 100.0 | |
| KOG3514|consensus | 1591 | 99.83 | ||
| KOG4289|consensus | 2531 | 99.82 | ||
| KOG3516|consensus | 1306 | 99.7 | ||
| KOG4289|consensus | 2531 | 99.65 | ||
| KOG1219|consensus | 4289 | 99.61 | ||
| KOG3514|consensus | 1591 | 99.55 | ||
| KOG3516|consensus | 1306 | 99.16 | ||
| cd00110 | 151 | LamG Laminin G domain; Laminin G-like domains are | 99.12 | |
| PF00054 | 131 | Laminin_G_1: Laminin G domain; InterPro: IPR012679 | 98.94 | |
| smart00282 | 135 | LamG Laminin G domain. | 98.8 | |
| KOG1219|consensus | 4289 | 98.68 | ||
| PF02210 | 128 | Laminin_G_2: Laminin G domain; InterPro: IPR012680 | 98.51 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 98.37 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.98 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.8 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 97.62 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 97.51 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 97.23 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 97.19 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 96.98 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 96.03 | |
| smart00210 | 184 | TSPN Thrombospondin N-terminal -like domains. Hepa | 95.92 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 95.51 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 95.18 | |
| KOG3509|consensus | 964 | 93.78 | ||
| PF12955 | 103 | DUF3844: Domain of unknown function (DUF3844); Int | 93.33 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 91.4 | |
| PF12273 | 130 | RCR: Chitin synthesis regulation, resistance to Co | 87.45 | |
| KOG1214|consensus | 1289 | 87.26 | ||
| PF00354 | 195 | Pentaxin: Pentaxin family; InterPro: IPR001759 Pen | 86.96 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 85.29 | |
| KOG4260|consensus | 350 | 84.87 | ||
| smart00159 | 206 | PTX Pentraxin / C-reactive protein / pentaxin fami | 84.64 | |
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 82.46 | |
| PF04863 | 56 | EGF_alliinase: Alliinase EGF-like domain; InterPro | 82.38 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 82.07 | |
| KOG1217|consensus | 487 | 81.44 | ||
| PF05568 | 189 | ASFV_J13L: African swine fever virus J13L protein; | 81.27 | |
| PF12946 | 37 | EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 | 80.14 |
| >PF01049 Cadherin_C: Cadherin cytoplasmic region; InterPro: IPR000233 Cadherins are transmembrane glycoproteins vital in calcium-dependent cell-cell adhesion during tissue differentiation [] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7e-35 Score=246.11 Aligned_cols=111 Identities=50% Similarity=0.801 Sum_probs=34.8
Q ss_pred CCCCchhhcccccccCCCCCccCCCcccccccCCCCCCCC-CCccCCC-C-CCCCCCCCCCCCcHHHHHHHHHHHhcCCC
Q psy592 228 PGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPH-PEMNNKI-P-YGLGPMPMGVEPNVGIFIEEHKKRADADP 304 (339)
Q Consensus 228 ~~~~~d~reni~~Y~eEggGE~d~~~yd~~~L~~~~~~~~-~~~~~~~-~-~~~~~~~~~~~~~~~~~i~~~~~~ad~d~ 304 (339)
..++||||||||+|||||||||||+||||++|++|...+. ..+.|.. + +...+.+.....+|++||++||++||.||
T Consensus 13 ~~~~ediReNii~YddEGGGEeD~~aydi~~L~~~~~~~~~~~~~P~~~~~~~~~~~~~~~~~~~~~~i~~kl~~ad~d~ 92 (149)
T PF01049_consen 13 PDEEEDIRENIINYDDEGGGEEDTEAYDISALQNPSQPRSRRDILPLIRALPRYPPPPPPDSPDIGDFISQKLQEADEDP 92 (149)
T ss_dssp -----------------TT---------GGG--------EEEEE--TTSS---------SSGGGHHHHHHHHHHHHHT-T
T ss_pred CCcHHHHhcCceecccCcCCcCCCCccchhhhhCccccccccccccccccccccccccCCCchHHHHHHHHHHHHcCCcc
Confidence 5688999999999999999999999999999999877510 0011100 0 00011122456799999999999999999
Q ss_pred CCCCCCcceeeeecCCCCCcccccccccCCCCCC
Q psy592 305 NAPPFDDLRNYAYEGGGSTAGSLSSLASGSSIKN 338 (339)
Q Consensus 305 ~~~p~Dsl~~y~~EG~gS~agSlssl~s~~~~~~ 338 (339)
++||||+|++|+|||.||+|||||||+|.+++++
T Consensus 93 ~~~p~Dsl~~Y~~EG~gS~agSLSSL~S~s~~~~ 126 (149)
T PF01049_consen 93 SAPPYDSLQVYAYEGQGSSAGSLSSLESCSSDEE 126 (149)
T ss_dssp TSSS-EEEEE----------TT------------
T ss_pred ccccccceeeeccCCCCCcCCCcccccCCCcccc
Confidence 9999999999999999999999999999886543
|
Cadherins cluster to form foci of homophilic binding units. A key determinant to the strength of the binding that it is mediated by cadherins is the juxtamembrane region of the cadherin. This region induces clustering and also binds to the protein p120ctn []. The cytoplasmic region is highly conserved in sequence and has been shown experimentally to regulate the cell-cell binding function of the extracellular domain of E-cadherin, possibly through interaction with the cytoskeleton []. This domain is found upstream of the cadherin domain IPR002126 from INTERPRO.; GO: 0005509 calcium ion binding, 0007156 homophilic cell adhesion, 0016020 membrane; PDB: 2KOH_B 3IFQ_D 1I7X_D 1I7W_D 3L6Y_F 3L6X_B. |
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >smart00282 LamG Laminin G domain | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >smart00210 TSPN Thrombospondin N-terminal -like domains | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >smart00159 PTX Pentraxin / C-reactive protein / pentaxin family | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >PF04863 EGF_alliinase: Alliinase EGF-like domain; InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >PF05568 ASFV_J13L: African swine fever virus J13L protein; InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ] | Back alignment and domain information |
|---|
| >PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 339 | |||
| 1i7w_B | 151 | E-cadherin, epithelial-cadherin; cell adhesion, be | 8e-35 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 1e-24 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 6e-23 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 7e-19 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 8e-16 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 3e-08 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 4e-07 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 1e-06 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 2e-21 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 7e-07 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 8e-17 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 4e-11 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 3e-09 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 3e-15 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 4e-14 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 1e-13 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 3e-13 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 4e-13 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 1e-12 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 2e-10 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 1e-11 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 3e-11 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 1e-10 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 4e-04 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 8e-10 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 1e-09 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 7e-09 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 1e-08 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 2e-08 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 2e-07 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 2e-04 |
| >1i7w_B E-cadherin, epithelial-cadherin; cell adhesion, beta-catenin, protein-protein complex, extended interface, armadillo repeat, phosphoserin; HET: SEP; 2.00A {Mus musculus} SCOP: j.71.1.1 PDB: 1i7x_B 3ifq_C* Length = 151 | Back alignment and structure |
|---|
Score = 123 bits (310), Expect = 8e-35
Identities = 51/123 (41%), Positives = 67/123 (54%), Gaps = 8/123 (6%)
Query: 220 RREAHIKYP--GPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPHPEMNNKIPYG 277
RR +K P PDDD R+N+ YD+EGGGE+D FD++ L + N +
Sbjct: 1 RRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEED-QDFDLSQLHRGLDARPEVTRNDVAPT 59
Query: 278 LGPMPMGVEP-----NVGIFIEEHKKRADADPNAPPFDDLRNYAYEGGGSTAGSLSSLAS 332
L +P +G FI+E+ K AD+DP APP+D L + YEG GS A SLSSL S
Sbjct: 60 LMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSGSEAASLSSLNS 119
Query: 333 GSS 335
S
Sbjct: 120 SES 122
|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 339 | |||
| 1i7w_B | 151 | E-cadherin, epithelial-cadherin; cell adhesion, be | 100.0 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 99.97 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 99.91 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 99.88 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 99.87 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 99.55 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 99.49 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 99.46 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 99.45 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 99.42 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 99.41 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 99.4 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 99.38 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 99.38 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 99.34 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 99.33 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 99.33 | |
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 99.29 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 99.28 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 99.27 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 99.26 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 99.23 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 99.22 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 99.16 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.96 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 98.96 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.73 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.44 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.43 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 98.43 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 98.42 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 98.37 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 98.29 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.18 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.99 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 97.93 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 97.91 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 97.83 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.66 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 97.64 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.63 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 97.62 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 97.54 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.53 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 97.5 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 97.47 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.43 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.42 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 97.41 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 97.33 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 97.29 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 97.21 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 97.12 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 97.11 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 97.07 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 97.04 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 96.94 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 96.92 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 96.91 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 96.76 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 96.67 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 96.59 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 96.2 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 96.19 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 95.99 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 95.98 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 95.83 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 95.6 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 95.59 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 95.49 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 95.46 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 95.15 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 95.12 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 95.06 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 95.04 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 94.83 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 94.62 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 94.54 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 94.47 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 94.34 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 94.24 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 94.2 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 94.19 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 94.02 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 94.0 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 93.91 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 93.85 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 93.75 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 93.56 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 93.52 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 93.51 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 93.47 | |
| 2jwa_A | 44 | Receptor tyrosine-protein kinase ERBB-2; transmemb | 93.33 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 93.2 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 93.0 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 92.57 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 92.46 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 92.21 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 92.02 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 91.65 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 91.58 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 91.51 | |
| 2erf_A | 209 | Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug | 91.15 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 91.14 | |
| 2uur_A | 245 | Collagen alpha-1(IX) chain; glycoprotein, hydroxyl | 89.77 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 89.56 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 89.36 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 89.31 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 89.01 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 88.42 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 88.13 | |
| 1za4_A | 251 | Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel | 87.85 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 87.56 | |
| 2ks1_B | 44 | Epidermal growth factor receptor; ERBB1, ERBB2, tr | 87.55 | |
| 2l2t_A | 44 | Receptor tyrosine-protein kinase ERBB-4; transmemb | 87.34 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 87.15 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 86.6 | |
| 3pvn_A | 206 | C-reactive protein; pentraxin family, immune syste | 86.25 | |
| 3kqr_A | 204 | Serum amyloid P-component; glycoprotein, disulfide | 85.34 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 84.5 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 84.21 | |
| 3flp_A | 217 | SAP-like pentraxin; physiological doubly-stacked h | 83.48 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 83.09 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 83.05 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 82.27 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 82.15 | |
| 2v73_A | 191 | CBM40, putative EXO-alpha-sialidase; carbohydrate- | 80.65 |
| >1i7w_B E-cadherin, epithelial-cadherin; cell adhesion, beta-catenin, protein-protein complex, extended interface, armadillo repeat, phosphoserin; HET: SEP; 2.00A {Mus musculus} SCOP: j.71.1.1 PDB: 1i7x_B 3ifq_C* | Back alignment and structure |
|---|
Probab=100.00 E-value=7.7e-37 Score=254.21 Aligned_cols=113 Identities=39% Similarity=0.615 Sum_probs=34.0
Q ss_pred cCCCCCCchhhcccccccCCCCCccCCCcccccccCCCCCCCCC----CccCCCC-CCCCCCCCCCCCcHHHHHHHHHHH
Q psy592 225 IKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPHP----EMNNKIP-YGLGPMPMGVEPNVGIFIEEHKKR 299 (339)
Q Consensus 225 ~~~~~~~~d~reni~~Y~eEggGE~d~~~yd~~~L~~~~~~~~~----~~~~~~~-~~~~~~~~~~~~~~~~~i~~~~~~ 299 (339)
..+..++||||||||+|||||||||||+ |||++||+|...... .+.|... ..+.+..+..+.+|++||.+||++
T Consensus 8 ~~l~~~~dDiReNIi~YddEGGGEeD~~-yDi~~L~~p~~~~~~~~r~d~~P~~~~~~~~~~~~~~~~~v~~fi~~kl~~ 86 (151)
T 1i7w_B 8 EPLLPPDDDTRDNVYYYDEEGGGEEDQD-FDLSQLHRGLDARPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKA 86 (151)
T ss_dssp -----------------------------------------------------------------------------CHH
T ss_pred ccCCcchhhhhhhheecccccCccccCC-cCHHHHcCcccccccccccCcCcccccccccCCCCCCcchHHHHHHHHHHH
Confidence 3445678999999999999999999999 999999998764211 1222110 001111111345899999999999
Q ss_pred hcCCCCCCCCCcceeeeecCCCCCcccccccccCCCCCC
Q psy592 300 ADADPNAPPFDDLRNYAYEGGGSTAGSLSSLASGSSIKN 338 (339)
Q Consensus 300 ad~d~~~~p~Dsl~~y~~EG~gS~agSlssl~s~~~~~~ 338 (339)
||+||++||||+||+|+|||.||+|||||||+|++++++
T Consensus 87 ad~D~~~~p~D~l~~Y~yEG~gS~agSLSsl~S~~~~~d 125 (151)
T 1i7w_B 87 ADSDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDQD 125 (151)
T ss_dssp HHHCTTSSCCCCCCCCCCCCCCCCCTTCCCC--------
T ss_pred ccCCCCcCCccceeeeeecCCCCccCccccccccCcccC
Confidence 999999999999999999999999999999999877543
|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* | Back alignment and structure |
|---|
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A | Back alignment and structure |
|---|
| >3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 339 | ||||
| d1dyka1 | 189 | b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse | 2e-09 | |
| d1h30a1 | 191 | b.29.1.4 (A:261-451) Growth-arrest-specific protei | 1e-08 | |
| d1h30a2 | 218 | b.29.1.4 (A:461-678) Growth-arrest-specific protei | 1e-06 | |
| d1dyka2 | 185 | b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse | 2e-06 | |
| d1pz7a_ | 195 | b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI | 3e-06 | |
| d2r1da1 | 177 | b.29.1.4 (A:36-212) Ligand-binding domain of neure | 1e-05 | |
| d1d2sa_ | 170 | b.29.1.4 (A:) Sex hormone-binding globulin {Human | 2e-05 | |
| d1l3ya_ | 41 | g.3.11.6 (A:) Integrin beta EGF-like domains {Huma | 7e-05 | |
| d1autl1 | 48 | g.3.11.1 (L:49-96) Activated protein c (autoprothr | 4e-04 |
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Laminin G-like module domain: Laminin alpha2 chain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 54.5 bits (130), Expect = 2e-09
Identities = 18/81 (22%), Positives = 36/81 (44%), Gaps = 8/81 (9%)
Query: 71 CVTPTSPVT--------FKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHN 122
CV + P S+I A K ++L+ RT E G LF ++ ++
Sbjct: 4 CVAESEPALLTGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINH 63
Query: 123 REYAILEIKDSKLRFRYNLNN 143
++A +++++ F Y+L +
Sbjct: 64 ADFATVQLRNGFPYFSYDLGS 84
|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 | Back information, alignment and structure |
|---|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 339 | |||
| d1h30a1 | 191 | Growth-arrest-specific protein Gas6 {Human (Homo s | 99.45 | |
| d1dyka1 | 189 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 99.41 | |
| d2r1da1 | 177 | Ligand-binding domain of neurexin 1beta {Rat (Ratt | 99.17 | |
| d1pz7a_ | 195 | Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.17 | |
| d1d2sa_ | 170 | Sex hormone-binding globulin {Human (Homo sapiens) | 99.16 | |
| d1dyka2 | 185 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 99.14 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.07 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.06 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 99.06 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 99.04 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 99.04 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 99.01 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.95 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.91 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.88 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 98.83 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.8 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.78 | |
| d1h30a2 | 218 | Growth-arrest-specific protein Gas6 {Human (Homo s | 98.61 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 98.59 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 98.41 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 98.32 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 97.67 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 97.63 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 97.51 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 97.39 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.38 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.08 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.05 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 96.89 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.78 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 96.52 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.23 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 96.19 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 96.17 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 96.0 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.79 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 94.53 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 94.52 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 93.75 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 93.12 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 92.4 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 91.86 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 91.55 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 89.33 | |
| d2erfa1 | 206 | Thrombospondin 1 N-terminal domain {Human (Homo sa | 81.88 | |
| d1b09a_ | 206 | C-reactive protein (CRP) {Human (Homo sapiens) [Ta | 81.77 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 80.13 |
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Laminin G-like module domain: Growth-arrest-specific protein Gas6 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.45 E-value=2.2e-13 Score=116.55 Aligned_cols=109 Identities=13% Similarity=0.188 Sum_probs=73.6
Q ss_pred CCCCCeeecCCCCceeeCCCCCCCCCCCCCCCCccccCcceEEEeccCCCCccccEEEEEEeecCCceEEEEEecCCCCc
Q psy592 45 YPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHNRE 124 (339)
Q Consensus 45 C~~~g~Cv~~~~~~~C~C~~g~~G~~Ce~~~~~~~F~~~s~v~y~~~~~~~~~~~~i~l~frT~~~~GlL~~~~~~~~~~ 124 (339)
|+++.+|.+ .|.|.+...+..++.......|.+.+++...+.... .....|+|+|||++++|+|||+.+....+
T Consensus 11 ~~~~~~Ce~-----~~~c~~~~~~~~~~~~~~~~~f~g~~~~~~~~~~~~-~~~~~i~~~FrT~~~~GlL~~~~~~~~~~ 84 (191)
T d1h30a1 11 SQDMDTCED-----ILPCVPFSVAKSVKSLYLGRMFSGTPVIRLRFKRLQ-PTRLVAEFDFRTFDPEGILLFAGGHQDST 84 (191)
T ss_dssp ETTTTEEEE-----CCCSSCBCCCEETTEEECCC-----CCEEEECCBSS-CCCCEEEEEEEECCSSEEEEEEESCTTSE
T ss_pred cccCCCCcc-----cccccCCCcCccceeeEeccccCCCceEEEEeccCC-CCceEEEEEEEeCCCCeEEEEEcCCCCCc
Confidence 555666653 245666554444443323456777766655543222 23579999999999999999998766678
Q ss_pred eEEEEEECCEEEEEEecCCCcccceeEEe-cccccCccc
Q psy592 125 YAILEIKDSKLRFRYNLNNLKTDEKDIWL-NAIKDSKLR 162 (339)
Q Consensus 125 ~i~L~L~~G~l~~~~~lG~~~~~~~~l~~-~~v~dG~WH 162 (339)
|+.|+|.+|++.+.+++|+. ...+.. ..++||+||
T Consensus 85 fi~l~l~~G~l~~~~~~g~~---~~~~~~~~~v~Dg~WH 120 (191)
T d1h30a1 85 WIVLALRAGRLELQLRYNGV---GRVTSSGPVINHGMWQ 120 (191)
T ss_dssp EEEEEEETTEEEEEEEETTE---EEEEEEEEECCSSCCE
T ss_pred EEEEEEECCEEEEEEEcCCC---cEEecCCccccCCCEE
Confidence 99999999999999999874 334443 478999999
|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|