Psyllid ID: psy592


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MENILNIVTITYLYDLANPGLHKNSVPGCPATEAVCNAHSRLHCYPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHNREYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAVAVNDGQWHFVKTGSALFVTLLISPNQVLVLVFVVYSRRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPHPEMNNKIPYGLGPMPMGVEPNVGIFIEEHKKRADADPNAPPFDDLRNYAYEGGGSTAGSLSSLASGSSIKNN
cccccEEEEccEEccccccccccccccccccccccccccccccccccccEEccccccEEEEccccccccccccccccEEEccccEEEEEccccccccccEEEEEEEcccccEEEEEEEccccccEEEEEEEcccEEEEEEccccccccccccccEEccccEEEEEEEcccccccccEEcccEEEccccccEEEccccEEEEEEEcccHHHEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccEEEccccccccccccccccccccccccc
ccccEEEEEccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccEcccccEEEEcccccccccccEEEEEEEEEcccEEEEEEcccccccEEEEEEEccEEEEEEEcccccEEEEEEccEEEccccEEEEEEEEEcccEEEEEEcccccccccccEEEEEEccccEEEEEcccEEEEEEEEEEccEEEEcccccccHHHcHHHEEEEccccccccccccEccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHEcccccccEcccccHHccccccccc
MENILNIVTITYLydlanpglhknsvpgcpateavcnahsrlhcypehgvcvgsmhtakcqclpgwsgtgcvtptspvtfkpqsYIKYALsfepdkytTQLQLKFRTREEFGELFRLSDQHNREYAILEIKDSKLRFRYNLnnlktdekDIWLNAIKDSKLRFRYNLnnlktdekdiWLNAVAVNDGQWHFVKTGSALFVTLLISPNQVLVLVFVVYSRRReahikypgpdddvreniinyddegggeddmtafditplqipiggphpemnnkipyglgpmpmgvepnvgiFIEEhkkradadpnappfddlrnyayegggstagslsslasgssiknn
MENILNIVTITYLYDLANPGLHKNSVPGCPATEAVCNAHSRLHCYPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGElfrlsdqhnreyaileikdsklrFRYNLnnlktdekdiwlnaikdsklRFRYNLNNLKTDEKDIWLNAVAVNDGQWHFVKTGSALFVTLLISPNQVLVLVFVVYSRRREAhikypgpdddvreNIINYDDEGGGEDDMTAFDITPLQIPIGGPHPEMNNKIPYGLGPMPMGVEPNVGIFIEEHKKRADADPNAPPFDDLRNYAYEGGGStagslsslasgssiknn
MENILNIVTITYLYDLANPGLHKNSVPGCPATEAVCNAHSRLHCYPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHNREYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAVAVNDGQWHFVKTGSALFVTLLISPNQVLVLVFVVYSRRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPHPEMNNKIPYGLGPMPMGVEPNVGIFIEEHKKRadadpnappfddLRNYAYEgggstagslsslasgssIKNN
***ILNIVTITYLYDLANPGLHKNSVPGCPATEAVCNAHSRLHCYPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHNREYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAVAVNDGQWHFVKTGSALFVTLLISPNQVLVLVFVVYSRRREAHIKYPGPDDDVRENIINYD********MTAFDITPLQIPIG*********IPYGLGPMPMGVEPNVGIFI**********************************************
*ENILNIVTITYLYDLANPGL***********EAVCNAHSRLHCYPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHNREYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAVAVNDGQWHFVKTGSALFVTLLISPNQVLVLVFVVYSRRR**********DDVRENIINYDDEGGGEDDMTAFDIT*********************************IFIEEHKKRADADPNAPPFDDLRNYAYEGGGSTA***************
MENILNIVTITYLYDLANPGLHKNSVPGCPATEAVCNAHSRLHCYPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHNREYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAVAVNDGQWHFVKTGSALFVTLLISPNQVLVLVFVVYSRRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPHPEMNNKIPYGLGPMPMGVEPNVGIFIEEHKKRADADPNAPPFDDLRNYAYEGGGST****************
*ENILNIVTITYLYDLANPGLH**SVPGCPATEAVCNAHSRLHCYPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHNREYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAVAVNDGQWHFVKTGSALFVTLLISPNQVLVLVFVVYSRRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPHPEMNNKIPYGLGPMPMGVEPNVGIFIEEHKKRADADPNAPPFDDLRNYAYEGGG******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENILNIVTITYLYDLANPGLHKNSVPGCPATEAVCNAHSRLHCYPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHNREYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAVAVNDGQWHFVKTGSALFVTLLISPNQVLVLVFVVYSRRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPHPEMNNKIPYGLGPMPMGVEPNVGIFIEEHKKRADADPNAPPFDDLRNYAYEGGGSTAGSLSSLASGSSIKNN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query339 2.2.26 [Sep-21-2011]
O15943 3097 Neural-cadherin OS=Drosop yes N/A 0.507 0.055 0.561 1e-59
Q9VJB6 2215 Putative neural-cadherin no N/A 0.507 0.077 0.487 2e-49
O93319792 Cadherin-11 OS=Gallus gal yes N/A 0.412 0.176 0.444 2e-19
P55288796 Cadherin-11 OS=Mus muscul yes N/A 0.412 0.175 0.444 3e-19
P55287796 Cadherin-11 OS=Homo sapie yes N/A 0.412 0.175 0.444 3e-19
Q08DJ5790 Cadherin-18 OS=Bos taurus no N/A 0.418 0.179 0.36 5e-18
Q13634790 Cadherin-18 OS=Homo sapie no N/A 0.418 0.179 0.353 8e-18
Q9H159772 Cadherin-19 OS=Homo sapie no N/A 0.345 0.151 0.439 8e-18
P70407786 Cadherin-9 OS=Mus musculu no N/A 0.395 0.170 0.375 3e-17
Q5RJH3794 Cadherin-12 OS=Mus muscul no N/A 0.401 0.171 0.386 3e-17
>sp|O15943|CADN_DROME Neural-cadherin OS=Drosophila melanogaster GN=CadN PE=1 SV=2 Back     alignment and function desciption
 Score =  230 bits (587), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 136/203 (66%), Gaps = 31/203 (15%)

Query: 4    ILNIVTITYLYDLANPGLHKNSVPGCPATEAVC-NAHSRLHCYPEHGVCVGSMHTAKCQC 62
            I N+V  + LYDLA+PGL +NSV GCP TE VC    +   C+ EHG CVGS+  A+C C
Sbjct: 2560 IRNLVHNSKLYDLAHPGLSRNSVAGCPQTEEVCAQTETTARCW-EHGNCVGSLSEARCHC 2618

Query: 63   LPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHN 122
             PGW+G  C  PT P TFK QSY+KYALSFEPD+++TQ+QL+FRTREE+GELFR+SDQHN
Sbjct: 2619 RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFSTQVQLRFRTREEYGELFRVSDQHN 2678

Query: 123  REYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAV 182
            REY ILEIKD  L FRYNLN+L+T+EKD+WLNAI                          
Sbjct: 2679 REYGILEIKDGHLHFRYNLNSLRTEEKDLWLNAI-------------------------- 2712

Query: 183  AVNDGQWHFVKT---GSALFVTL 202
             VNDGQWH VK    GSA  + L
Sbjct: 2713 VVNDGQWHVVKVNRYGSAATLEL 2735




Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. May associate with arm neural isoform and participate in the transmission of developmental information.
Drosophila melanogaster (taxid: 7227)
>sp|Q9VJB6|CADN2_DROME Putative neural-cadherin 2 OS=Drosophila melanogaster GN=CadN2 PE=3 SV=2 Back     alignment and function description
>sp|O93319|CAD11_CHICK Cadherin-11 OS=Gallus gallus GN=CDH11 PE=2 SV=1 Back     alignment and function description
>sp|P55288|CAD11_MOUSE Cadherin-11 OS=Mus musculus GN=Cdh11 PE=1 SV=1 Back     alignment and function description
>sp|P55287|CAD11_HUMAN Cadherin-11 OS=Homo sapiens GN=CDH11 PE=1 SV=2 Back     alignment and function description
>sp|Q08DJ5|CAD18_BOVIN Cadherin-18 OS=Bos taurus GN=CDH18 PE=2 SV=1 Back     alignment and function description
>sp|Q13634|CAD18_HUMAN Cadherin-18 OS=Homo sapiens GN=CDH18 PE=2 SV=1 Back     alignment and function description
>sp|Q9H159|CAD19_HUMAN Cadherin-19 OS=Homo sapiens GN=CDH19 PE=2 SV=1 Back     alignment and function description
>sp|P70407|CADH9_MOUSE Cadherin-9 OS=Mus musculus GN=Cdh9 PE=2 SV=2 Back     alignment and function description
>sp|Q5RJH3|CAD12_MOUSE Cadherin-12 OS=Mus musculus GN=Cdh12 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
345493993 3062 PREDICTED: LOW QUALITY PROTEIN: neural-c 0.507 0.056 0.586 1e-61
110764123 3043 PREDICTED: neural-cadherin [Apis mellife 0.507 0.056 0.586 8e-61
307174406 1686 Neural-cadherin [Camponotus floridanus] 0.507 0.102 0.581 4e-60
350418529 3006 PREDICTED: neural-cadherin-like [Bombus 0.507 0.057 0.581 4e-60
340722540 3006 PREDICTED: neural-cadherin-like [Bombus 0.507 0.057 0.581 5e-60
307200809 1625 Neural-cadherin [Harpegnathos saltator] 0.507 0.105 0.586 9e-60
322793232 1797 hypothetical protein SINV_09531 [Solenop 0.507 0.095 0.581 9e-60
383864729 1849 PREDICTED: neural-cadherin-like [Megachi 0.507 0.093 0.581 3e-59
189237687 3035 PREDICTED: similar to Neural-cadherin pr 0.510 0.057 0.554 2e-58
158298606 1698 AGAP009726-PA [Anopheles gambiae str. PE 0.510 0.101 0.559 5e-58
>gi|345493993|ref|XP_003427197.1| PREDICTED: LOW QUALITY PROTEIN: neural-cadherin-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  243 bits (619), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 119/203 (58%), Positives = 142/203 (69%), Gaps = 31/203 (15%)

Query: 4    ILNIVTITYLYDLANPGLHKNSVPGCPATEAVCN-AHSRLHCYPEHGVCVGSMHTAKCQC 62
            I N+   + LYDLA+PGL +NSV GCP TE +CN   S   C+ EHG CVGS   A+CQC
Sbjct: 2518 IKNLFHNSKLYDLAHPGLSRNSVAGCPQTEEICNNQESTTRCW-EHGTCVGSFSEARCQC 2576

Query: 63   LPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHN 122
             PGW+G GC+TPT P TFKPQSY+KYALSFEPDKY+TQ+QL+FRTRE  GELFR+SDQHN
Sbjct: 2577 NPGWTGPGCMTPTIPTTFKPQSYVKYALSFEPDKYSTQIQLRFRTREVHGELFRVSDQHN 2636

Query: 123  REYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAIKDSKLRFRYNLNNLKTDEKDIWLNAV 182
            REYA+LEIKDS+LRFRYNLNN++T+E+DIWL AI                          
Sbjct: 2637 REYAVLEIKDSRLRFRYNLNNMRTEERDIWLTAI-------------------------- 2670

Query: 183  AVNDGQWHFVKT---GSALFVTL 202
            AV+DGQWH V+    GSA  + L
Sbjct: 2671 AVDDGQWHTVRVSRYGSAATLEL 2693




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|110764123|ref|XP_392099.3| PREDICTED: neural-cadherin [Apis mellifera] Back     alignment and taxonomy information
>gi|307174406|gb|EFN64925.1| Neural-cadherin [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350418529|ref|XP_003491887.1| PREDICTED: neural-cadherin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340722540|ref|XP_003399662.1| PREDICTED: neural-cadherin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307200809|gb|EFN80862.1| Neural-cadherin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322793232|gb|EFZ16889.1| hypothetical protein SINV_09531 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383864729|ref|XP_003707830.1| PREDICTED: neural-cadherin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|189237687|ref|XP_969192.2| PREDICTED: similar to Neural-cadherin precursor (Cadherin-N protein) (DN-cadherin) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158298606|ref|XP_001238044.2| AGAP009726-PA [Anopheles gambiae str. PEST] gi|157013965|gb|EAU76028.2| AGAP009726-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query339
FB|FBgn0015609 3097 CadN "Cadherin-N" [Drosophila 0.448 0.049 0.655 8.6e-92
FB|FBgn0262018 2215 CadN2 "Cadherin-N2" [Drosophil 0.448 0.068 0.564 1.6e-66
ZFIN|ZDB-GENE-100922-84 2780 si:dkey-22o22.2 "si:dkey-22o22 0.404 0.049 0.326 1.9e-19
UNIPROTKB|F1NHQ1 2501 LOC427547 "Uncharacterized pro 0.383 0.051 0.312 1.7e-18
UNIPROTKB|F1NBM7 2449 LOC414835 "Uncharacterized pro 0.404 0.055 0.311 8.5e-18
UNIPROTKB|F1P3P7 2530 LOC414835 "Uncharacterized pro 0.404 0.054 0.304 3.7e-17
UNIPROTKB|F1NHQ5 2500 LOC427547 "Uncharacterized pro 0.383 0.052 0.312 3.8e-17
UNIPROTKB|F1NJK1 2537 LOC427547 "Uncharacterized pro 0.383 0.051 0.312 3.3e-16
ZFIN|ZDB-GENE-980526-170800 cdh11 "cadherin 11, osteoblast 0.587 0.248 0.274 7.4e-10
UNIPROTKB|K7GLK6670 CDH11 "Uncharacterized protein 0.483 0.244 0.299 7.9e-09
FB|FBgn0015609 CadN "Cadherin-N" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 556 (200.8 bits), Expect = 8.6e-92, Sum P(2) = 8.6e-92
 Identities = 101/154 (65%), Positives = 122/154 (79%)

Query:     4 ILNIVTITYLYDLANPGLHKNSVPGCPATEAVC-NAHSRLHCYPEHGVCVGSMHTAKCQC 62
             I N+V  + LYDLA+PGL +NSV GCP TE VC    +   C+ EHG CVGS+  A+C C
Sbjct:  2560 IRNLVHNSKLYDLAHPGLSRNSVAGCPQTEEVCAQTETTARCW-EHGNCVGSLSEARCHC 2618

Query:    63 LPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHN 122
              PGW+G  C  PT P TFK QSY+KYALSFEPD+++TQ+QL+FRTREE+GELFR+SDQHN
Sbjct:  2619 RPGWTGPACNIPTIPTTFKAQSYVKYALSFEPDRFSTQVQLRFRTREEYGELFRVSDQHN 2678

Query:   123 REYAILEIKDSKLRFRYNLNNLKTDEKDIWLNAI 156
             REY ILEIKD  L FRYNLN+L+T+EKD+WLNAI
Sbjct:  2679 REYGILEIKDGHLHFRYNLNSLRTEEKDLWLNAI 2712


GO:0005911 "cell-cell junction" evidence=IDA
GO:0016021 "integral to membrane" evidence=ISS
GO:0007156 "homophilic cell adhesion" evidence=ISS;IDA
GO:0005886 "plasma membrane" evidence=ISS;IDA;TAS
GO:0016339 "calcium-dependent cell-cell adhesion" evidence=ISS;IPI
GO:0005515 "protein binding" evidence=IPI
GO:0007413 "axonal fasciculation" evidence=TAS
GO:0050839 "cell adhesion molecule binding" evidence=ISS
GO:0005887 "integral to plasma membrane" evidence=ISS
GO:0004872 "receptor activity" evidence=ISS
GO:0007155 "cell adhesion" evidence=NAS
GO:0007412 "axon target recognition" evidence=IMP
GO:0008013 "beta-catenin binding" evidence=NAS
GO:0007411 "axon guidance" evidence=IGI;IMP;NAS
GO:0050774 "negative regulation of dendrite morphogenesis" evidence=IMP
GO:0048846 "axon extension involved in axon guidance" evidence=IMP
GO:0016318 "ommatidial rotation" evidence=IMP
GO:0045463 "R8 cell development" evidence=IMP
GO:0044331 "cell-cell adhesion mediated by cadherin" evidence=IDA
GO:0045467 "R7 cell development" evidence=IMP
GO:0031290 "retinal ganglion cell axon guidance" evidence=IMP
GO:0048841 "regulation of axon extension involved in axon guidance" evidence=IMP
GO:0048675 "axon extension" evidence=IMP
GO:0048814 "regulation of dendrite morphogenesis" evidence=IMP
GO:0045296 "cadherin binding" evidence=IPI
GO:0005509 "calcium ion binding" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IPI
FB|FBgn0262018 CadN2 "Cadherin-N2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-100922-84 si:dkey-22o22.2 "si:dkey-22o22.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHQ1 LOC427547 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBM7 LOC414835 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3P7 LOC414835 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHQ5 LOC427547 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJK1 LOC427547 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-170 cdh11 "cadherin 11, osteoblast" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|K7GLK6 CDH11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O15943CADN_DROMENo assigned EC number0.56150.50730.0555yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
pfam01049145 pfam01049, Cadherin_C, Cadherin cytoplasmic region 1e-50
cd00110151 cd00110, LamG, Laminin G domain; Laminin G-like do 2e-11
pfam02210124 pfam02210, Laminin_G_2, Laminin G domain 7e-08
smart00282132 smart00282, LamG, Laminin G domain 1e-07
>gnl|CDD|216265 pfam01049, Cadherin_C, Cadherin cytoplasmic region Back     alignment and domain information
 Score =  164 bits (418), Expect = 1e-50
 Identities = 59/121 (48%), Positives = 71/121 (58%), Gaps = 6/121 (4%)

Query: 219 RRREAHIKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGP----HPEMNNKI 274
           RRR+        +DD+RENIINYDDEGGGE+D  A+DI+ L+ P+        P ++   
Sbjct: 1   RRRKKEPLIIDKEDDIRENIINYDDEGGGEEDTDAYDISALRNPLDPLRRDVQPLISALP 60

Query: 275 PYGLGPMPMGVEPNVGIFIEEHKKRADADPNAPPFDDLRNYAYEGGGSTAGSLSSLASGS 334
                P P     +VG FI E    AD DP APP+D L  YAYEG GS AGSLSSL S S
Sbjct: 61  RPRPPPPPDP--GDVGDFIHEKLPEADNDPTAPPYDSLLTYAYEGRGSVAGSLSSLNSSS 118

Query: 335 S 335
           S
Sbjct: 119 S 119


Cadherins are vital in cell-cell adhesion during tissue differentiation. Cadherins are linked to the cytoskeleton by catenins. Catenins bind to the cytoplasmic tail of the cadherin. Cadherins cluster to form foci of homophilic binding units. A key determinant to the strength of the binding that it is mediated by cadherins is the juxtamembrane region of the cadherin. This region induces clustering and also binds to the protein p120ctn. Length = 145

>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain Back     alignment and domain information
>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 339
PF01049149 Cadherin_C: Cadherin cytoplasmic region; InterPro: 100.0
KOG3514|consensus 1591 99.83
KOG4289|consensus 2531 99.82
KOG3516|consensus1306 99.7
KOG4289|consensus 2531 99.65
KOG1219|consensus 4289 99.61
KOG3514|consensus 1591 99.55
KOG3516|consensus 1306 99.16
cd00110151 LamG Laminin G domain; Laminin G-like domains are 99.12
PF00054131 Laminin_G_1: Laminin G domain; InterPro: IPR012679 98.94
smart00282135 LamG Laminin G domain. 98.8
KOG1219|consensus 4289 98.68
PF02210128 Laminin_G_2: Laminin G domain; InterPro: IPR012680 98.51
PF0000832 EGF: EGF-like domain This is a sub-family of the P 98.37
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.98
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.8
cd0005336 EGF Epidermal growth factor domain, found in epide 97.62
smart0018135 EGF Epidermal growth factor-like domain. 97.51
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.23
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.19
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 96.98
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 96.03
smart00210184 TSPN Thrombospondin N-terminal -like domains. Hepa 95.92
PHA02887126 EGF-like protein; Provisional 95.51
PHA03099139 epidermal growth factor-like protein (EGF-like pro 95.18
KOG3509|consensus 964 93.78
PF12955103 DUF3844: Domain of unknown function (DUF3844); Int 93.33
PF1266224 cEGF: Complement Clr-like EGF-like 91.4
PF12273130 RCR: Chitin synthesis regulation, resistance to Co 87.45
KOG1214|consensus 1289 87.26
PF00354195 Pentaxin: Pentaxin family; InterPro: IPR001759 Pen 86.96
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 85.29
KOG4260|consensus350 84.87
smart00159206 PTX Pentraxin / C-reactive protein / pentaxin fami 84.64
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 82.46
PF0486356 EGF_alliinase: Alliinase EGF-like domain; InterPro 82.38
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 82.07
KOG1217|consensus487 81.44
PF05568189 ASFV_J13L: African swine fever virus J13L protein; 81.27
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 80.14
>PF01049 Cadherin_C: Cadherin cytoplasmic region; InterPro: IPR000233 Cadherins are transmembrane glycoproteins vital in calcium-dependent cell-cell adhesion during tissue differentiation [] Back     alignment and domain information
Probab=100.00  E-value=7e-35  Score=246.11  Aligned_cols=111  Identities=50%  Similarity=0.801  Sum_probs=34.8

Q ss_pred             CCCCchhhcccccccCCCCCccCCCcccccccCCCCCCCC-CCccCCC-C-CCCCCCCCCCCCcHHHHHHHHHHHhcCCC
Q psy592          228 PGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPH-PEMNNKI-P-YGLGPMPMGVEPNVGIFIEEHKKRADADP  304 (339)
Q Consensus       228 ~~~~~d~reni~~Y~eEggGE~d~~~yd~~~L~~~~~~~~-~~~~~~~-~-~~~~~~~~~~~~~~~~~i~~~~~~ad~d~  304 (339)
                      ..++||||||||+|||||||||||+||||++|++|...+. ..+.|.. + +...+.+.....+|++||++||++||.||
T Consensus        13 ~~~~ediReNii~YddEGGGEeD~~aydi~~L~~~~~~~~~~~~~P~~~~~~~~~~~~~~~~~~~~~~i~~kl~~ad~d~   92 (149)
T PF01049_consen   13 PDEEEDIRENIINYDDEGGGEEDTEAYDISALQNPSQPRSRRDILPLIRALPRYPPPPPPDSPDIGDFISQKLQEADEDP   92 (149)
T ss_dssp             -----------------TT---------GGG--------EEEEE--TTSS---------SSGGGHHHHHHHHHHHHHT-T
T ss_pred             CCcHHHHhcCceecccCcCCcCCCCccchhhhhCccccccccccccccccccccccccCCCchHHHHHHHHHHHHcCCcc
Confidence            5688999999999999999999999999999999877510 0011100 0 00011122456799999999999999999


Q ss_pred             CCCCCCcceeeeecCCCCCcccccccccCCCCCC
Q psy592          305 NAPPFDDLRNYAYEGGGSTAGSLSSLASGSSIKN  338 (339)
Q Consensus       305 ~~~p~Dsl~~y~~EG~gS~agSlssl~s~~~~~~  338 (339)
                      ++||||+|++|+|||.||+|||||||+|.+++++
T Consensus        93 ~~~p~Dsl~~Y~~EG~gS~agSLSSL~S~s~~~~  126 (149)
T PF01049_consen   93 SAPPYDSLQVYAYEGQGSSAGSLSSLESCSSDEE  126 (149)
T ss_dssp             TSSS-EEEEE----------TT------------
T ss_pred             ccccccceeeeccCCCCCcCCCcccccCCCcccc
Confidence            9999999999999999999999999999886543



Cadherins cluster to form foci of homophilic binding units. A key determinant to the strength of the binding that it is mediated by cadherins is the juxtamembrane region of the cadherin. This region induces clustering and also binds to the protein p120ctn []. The cytoplasmic region is highly conserved in sequence and has been shown experimentally to regulate the cell-cell binding function of the extracellular domain of E-cadherin, possibly through interaction with the cytoskeleton []. This domain is found upstream of the cadherin domain IPR002126 from INTERPRO.; GO: 0005509 calcium ion binding, 0007156 homophilic cell adhesion, 0016020 membrane; PDB: 2KOH_B 3IFQ_D 1I7X_D 1I7W_D 3L6Y_F 3L6X_B.

>KOG3514|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG3514|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>smart00282 LamG Laminin G domain Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>smart00210 TSPN Thrombospondin N-terminal -like domains Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>smart00159 PTX Pentraxin / C-reactive protein / pentaxin family Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>PF04863 EGF_alliinase: Alliinase EGF-like domain; InterPro: IPR006947 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF05568 ASFV_J13L: African swine fever virus J13L protein; InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ] Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query339
1i7w_B151 E-cadherin, epithelial-cadherin; cell adhesion, be 8e-35
1q55_A880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-24
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 6e-23
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 7e-19
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 8e-16
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-08
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-07
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-06
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 2e-21
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 7e-07
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 8e-17
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 4e-11
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 3e-09
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 3e-15
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 4e-14
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 1e-13
2jd4_A 383 Laminin subunit alpha-1; basement membrane protein 3e-13
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 4e-13
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 1e-12
1dyk_A 394 Laminin alpha 2 chain; metal binding protein; 2.0A 2e-10
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 1e-11
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 3e-11
1h30_A 422 GAS6, growth-arrest-specific protein; laminin G-do 1e-10
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 4e-04
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 8e-10
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 1e-09
3v64_A191 Low-density lipoprotein receptor-related protein; 7e-09
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 1e-08
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 2e-08
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 2e-07
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-04
>1i7w_B E-cadherin, epithelial-cadherin; cell adhesion, beta-catenin, protein-protein complex, extended interface, armadillo repeat, phosphoserin; HET: SEP; 2.00A {Mus musculus} SCOP: j.71.1.1 PDB: 1i7x_B 3ifq_C* Length = 151 Back     alignment and structure
 Score =  123 bits (310), Expect = 8e-35
 Identities = 51/123 (41%), Positives = 67/123 (54%), Gaps = 8/123 (6%)

Query: 220 RREAHIKYP--GPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPHPEMNNKIPYG 277
           RR   +K P   PDDD R+N+  YD+EGGGE+D   FD++ L   +        N +   
Sbjct: 1   RRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEED-QDFDLSQLHRGLDARPEVTRNDVAPT 59

Query: 278 LGPMPMGVEP-----NVGIFIEEHKKRADADPNAPPFDDLRNYAYEGGGSTAGSLSSLAS 332
           L  +P           +G FI+E+ K AD+DP APP+D L  + YEG GS A SLSSL S
Sbjct: 60  LMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSGSEAASLSSLNS 119

Query: 333 GSS 335
             S
Sbjct: 120 SES 122


>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
1i7w_B151 E-cadherin, epithelial-cadherin; cell adhesion, be 100.0
1q55_A880 EP-cadherin, C-cadherin; trans interaction, desmos 99.97
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 99.91
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 99.88
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 99.87
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 99.55
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 99.49
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 99.46
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 99.45
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.42
1h30_A 422 GAS6, growth-arrest-specific protein; laminin G-do 99.41
3v64_A191 Low-density lipoprotein receptor-related protein; 99.4
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 99.38
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 99.38
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.34
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 99.33
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 99.33
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 99.29
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 99.28
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 99.27
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 99.26
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 99.23
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 99.22
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 99.16
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.96
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 98.96
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.73
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.44
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.43
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 98.43
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.42
1nql_B53 Epidermal growth factor; cell surface receptor, ty 98.37
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.29
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.18
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.99
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 97.93
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 97.91
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 97.83
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.66
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 97.64
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.63
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 97.62
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.54
1aut_L114 Activated protein C; serine proteinase, plasma cal 97.53
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 97.5
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 97.47
2vh0_B134 Activated factor XA light chain; serine protease, 97.43
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.42
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 97.41
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 97.33
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 97.29
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 97.21
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 97.12
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 97.11
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 97.07
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 97.04
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 96.94
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 96.92
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 96.91
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 96.76
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 96.67
2i9a_A145 Urokinase-type plasminogen activator; growth facto 96.59
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 96.2
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 96.19
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 95.99
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 95.98
2bou_A143 EGF-like module containing mucin-like hormone rece 95.83
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 95.6
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 95.59
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 95.49
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 95.46
2bou_A143 EGF-like module containing mucin-like hormone rece 95.15
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 95.12
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 95.06
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 95.04
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 94.83
3p5b_L400 Low density lipoprotein receptor variant; B-propel 94.62
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 94.54
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 94.47
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 94.34
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 94.24
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 94.2
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 94.19
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 94.02
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 94.0
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 93.91
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 93.85
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 93.75
2vh0_B134 Activated factor XA light chain; serine protease, 93.56
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 93.52
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 93.51
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 93.47
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 93.33
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 93.2
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 93.0
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 92.57
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 92.46
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 92.21
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 92.02
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 91.65
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 91.58
3v65_B386 Low-density lipoprotein receptor-related protein; 91.51
2erf_A209 Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug 91.15
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 91.14
2uur_A245 Collagen alpha-1(IX) chain; glycoprotein, hydroxyl 89.77
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 89.56
1aut_L114 Activated protein C; serine proteinase, plasma cal 89.36
3v65_B386 Low-density lipoprotein receptor-related protein; 89.31
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 89.01
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 88.42
1szb_A170 Mannose binding lectin-associated serine protease- 88.13
1za4_A251 Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel 87.85
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 87.56
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 87.55
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 87.34
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 87.15
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 86.6
3pvn_A206 C-reactive protein; pentraxin family, immune syste 86.25
3kqr_A204 Serum amyloid P-component; glycoprotein, disulfide 85.34
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 84.5
3p5b_L400 Low density lipoprotein receptor variant; B-propel 84.21
3flp_A217 SAP-like pentraxin; physiological doubly-stacked h 83.48
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 83.09
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 83.05
1nzi_A159 Complement C1S component; calcium, innate immunity 82.27
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 82.15
2v73_A191 CBM40, putative EXO-alpha-sialidase; carbohydrate- 80.65
>1i7w_B E-cadherin, epithelial-cadherin; cell adhesion, beta-catenin, protein-protein complex, extended interface, armadillo repeat, phosphoserin; HET: SEP; 2.00A {Mus musculus} SCOP: j.71.1.1 PDB: 1i7x_B 3ifq_C* Back     alignment and structure
Probab=100.00  E-value=7.7e-37  Score=254.21  Aligned_cols=113  Identities=39%  Similarity=0.615  Sum_probs=34.0

Q ss_pred             cCCCCCCchhhcccccccCCCCCccCCCcccccccCCCCCCCCC----CccCCCC-CCCCCCCCCCCCcHHHHHHHHHHH
Q psy592          225 IKYPGPDDDVRENIINYDDEGGGEDDMTAFDITPLQIPIGGPHP----EMNNKIP-YGLGPMPMGVEPNVGIFIEEHKKR  299 (339)
Q Consensus       225 ~~~~~~~~d~reni~~Y~eEggGE~d~~~yd~~~L~~~~~~~~~----~~~~~~~-~~~~~~~~~~~~~~~~~i~~~~~~  299 (339)
                      ..+..++||||||||+|||||||||||+ |||++||+|......    .+.|... ..+.+..+..+.+|++||.+||++
T Consensus         8 ~~l~~~~dDiReNIi~YddEGGGEeD~~-yDi~~L~~p~~~~~~~~r~d~~P~~~~~~~~~~~~~~~~~v~~fi~~kl~~   86 (151)
T 1i7w_B            8 EPLLPPDDDTRDNVYYYDEEGGGEEDQD-FDLSQLHRGLDARPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKA   86 (151)
T ss_dssp             -----------------------------------------------------------------------------CHH
T ss_pred             ccCCcchhhhhhhheecccccCccccCC-cCHHHHcCcccccccccccCcCcccccccccCCCCCCcchHHHHHHHHHHH
Confidence            3445678999999999999999999999 999999998764211    1222110 001111111345899999999999


Q ss_pred             hcCCCCCCCCCcceeeeecCCCCCcccccccccCCCCCC
Q psy592          300 ADADPNAPPFDDLRNYAYEGGGSTAGSLSSLASGSSIKN  338 (339)
Q Consensus       300 ad~d~~~~p~Dsl~~y~~EG~gS~agSlssl~s~~~~~~  338 (339)
                      ||+||++||||+||+|+|||.||+|||||||+|++++++
T Consensus        87 ad~D~~~~p~D~l~~Y~yEG~gS~agSLSsl~S~~~~~d  125 (151)
T 1i7w_B           87 ADSDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDQD  125 (151)
T ss_dssp             HHHCTTSSCCCCCCCCCCCCCCCCCTTCCCC--------
T ss_pred             ccCCCCcCCccceeeeeecCCCCccCccccccccCcccC
Confidence            999999999999999999999999999999999877543



>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A Back     alignment and structure
>3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 339
d1dyka1189 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse 2e-09
d1h30a1191 b.29.1.4 (A:261-451) Growth-arrest-specific protei 1e-08
d1h30a2218 b.29.1.4 (A:461-678) Growth-arrest-specific protei 1e-06
d1dyka2185 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse 2e-06
d1pz7a_195 b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI 3e-06
d2r1da1177 b.29.1.4 (A:36-212) Ligand-binding domain of neure 1e-05
d1d2sa_170 b.29.1.4 (A:) Sex hormone-binding globulin {Human 2e-05
d1l3ya_41 g.3.11.6 (A:) Integrin beta EGF-like domains {Huma 7e-05
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 4e-04
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Laminin alpha2 chain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 54.5 bits (130), Expect = 2e-09
 Identities = 18/81 (22%), Positives = 36/81 (44%), Gaps = 8/81 (9%)

Query: 71  CVTPTSPVT--------FKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHN 122
           CV  + P              S+I  A      K    ++L+ RT  E G LF ++  ++
Sbjct: 4   CVAESEPALLTGSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINH 63

Query: 123 REYAILEIKDSKLRFRYNLNN 143
            ++A +++++    F Y+L +
Sbjct: 64  ADFATVQLRNGFPYFSYDLGS 84


>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query339
d1h30a1191 Growth-arrest-specific protein Gas6 {Human (Homo s 99.45
d1dyka1189 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.41
d2r1da1177 Ligand-binding domain of neurexin 1beta {Rat (Ratt 99.17
d1pz7a_195 Agrin {Chicken (Gallus gallus) [TaxId: 9031]} 99.17
d1d2sa_170 Sex hormone-binding globulin {Human (Homo sapiens) 99.16
d1dyka2185 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.14
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 99.07
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 99.06
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 99.06
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 99.04
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 99.04
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 99.01
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.95
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.91
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.88
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.83
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.8
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.78
d1h30a2218 Growth-arrest-specific protein Gas6 {Human (Homo s 98.61
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 98.59
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 98.41
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 98.32
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 97.67
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 97.63
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 97.51
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 97.39
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.38
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.08
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 96.89
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.78
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 96.52
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.23
d1i0ua241 Low density lipoprotein (LDL) receptor, different 96.19
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 96.17
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 96.0
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.79
d1szba245 Mannose-binding protein associated serine protease 94.53
d1nt0a345 Mannose-binding protein associated serine protease 94.52
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 93.75
d3bpse140 Low density lipoprotein (LDL) receptor, different 93.12
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 92.4
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 91.86
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 91.55
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 89.33
d2erfa1206 Thrombospondin 1 N-terminal domain {Human (Homo sa 81.88
d1b09a_206 C-reactive protein (CRP) {Human (Homo sapiens) [Ta 81.77
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 80.13
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Growth-arrest-specific protein Gas6
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.45  E-value=2.2e-13  Score=116.55  Aligned_cols=109  Identities=13%  Similarity=0.188  Sum_probs=73.6

Q ss_pred             CCCCCeeecCCCCceeeCCCCCCCCCCCCCCCCccccCcceEEEeccCCCCccccEEEEEEeecCCceEEEEEecCCCCc
Q psy592           45 YPEHGVCVGSMHTAKCQCLPGWSGTGCVTPTSPVTFKPQSYIKYALSFEPDKYTTQLQLKFRTREEFGELFRLSDQHNRE  124 (339)
Q Consensus        45 C~~~g~Cv~~~~~~~C~C~~g~~G~~Ce~~~~~~~F~~~s~v~y~~~~~~~~~~~~i~l~frT~~~~GlL~~~~~~~~~~  124 (339)
                      |+++.+|.+     .|.|.+...+..++.......|.+.+++...+.... .....|+|+|||++++|+|||+.+....+
T Consensus        11 ~~~~~~Ce~-----~~~c~~~~~~~~~~~~~~~~~f~g~~~~~~~~~~~~-~~~~~i~~~FrT~~~~GlL~~~~~~~~~~   84 (191)
T d1h30a1          11 SQDMDTCED-----ILPCVPFSVAKSVKSLYLGRMFSGTPVIRLRFKRLQ-PTRLVAEFDFRTFDPEGILLFAGGHQDST   84 (191)
T ss_dssp             ETTTTEEEE-----CCCSSCBCCCEETTEEECCC-----CCEEEECCBSS-CCCCEEEEEEEECCSSEEEEEEESCTTSE
T ss_pred             cccCCCCcc-----cccccCCCcCccceeeEeccccCCCceEEEEeccCC-CCceEEEEEEEeCCCCeEEEEEcCCCCCc
Confidence            555666653     245666554444443323456777766655543222 23579999999999999999998766678


Q ss_pred             eEEEEEECCEEEEEEecCCCcccceeEEe-cccccCccc
Q psy592          125 YAILEIKDSKLRFRYNLNNLKTDEKDIWL-NAIKDSKLR  162 (339)
Q Consensus       125 ~i~L~L~~G~l~~~~~lG~~~~~~~~l~~-~~v~dG~WH  162 (339)
                      |+.|+|.+|++.+.+++|+.   ...+.. ..++||+||
T Consensus        85 fi~l~l~~G~l~~~~~~g~~---~~~~~~~~~v~Dg~WH  120 (191)
T d1h30a1          85 WIVLALRAGRLELQLRYNGV---GRVTSSGPVINHGMWQ  120 (191)
T ss_dssp             EEEEEEETTEEEEEEEETTE---EEEEEEEEECCSSCCE
T ss_pred             EEEEEEECCEEEEEEEcCCC---cEEecCCccccCCCEE
Confidence            99999999999999999874   334443 478999999



>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure