Diaphorina citri psyllid: psy5931


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
AIIQFGKIARKHHLTSVCLDSLFRLYTIPSVPIVDCFEKIRQQVKCYLQMAALDGKNQLQEGLEVIEHTNLKYLTKEMTAEFYALKGMLLAQIGRSAEANKAFSAAVQMHDVMVKAWALWGDYMEAQFTNPSPPGSAPNMVLGVFAVTCFMHACRHQKESMSRKYLAKVDYIF
cHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcc
**IQFGKIARKHHLTSVCLDSLFRLYTIPSVPIVDCFEKIRQQVKCYLQMAALDGKNQLQEGLEVIEHTNLKYLTKEMTAEFYALKGMLLAQIGRSAEANKAFSAAVQMHDVMVKAWALWGDYMEAQFTNP****SAPNMVLGVFAVTCFMHACRHQKESMSRKYLAKVDYIF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AIIQFGKIARKHHLTSVCLDSLFRLYTIPSVPIVDCFEKIRQQVKCYLQMAALDGKNQLQEGLEVIEHTNLKYLTKEMTAEFYALKGMLLAQIGRSAEANKAFSAAVQMHDVMVKAWALWGDYMEAQFTNPSPPGSAPNMVLGVFAVTCFMHACRHQKESMSRKYLAKVDYIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transformation/transcription domain-associated protein Adapter protein, which is found in various multiprotein chromatin complexes with histone acetyltransferase activity (HAT), which gives a specific tag for epigenetic transcription activation. Component of the NuA4 histone acetyltransferase complex which is responsible for acetylation of nucleosomal histones H4 and H2A. Plays a central role in MYC transcription activation, and also participates in cell transformation by MYC. Required for p53/TP53-, E2F1- and E2F4-mediated transcription activation. Also involved in transcription activation mediated by the adenovirus E1A, a viral oncoprotein that deregulates transcription of key genes. Probably acts by linking transcription factors such as E1A, MYC or E2F1 to HAT complexes such as STAGA thereby allowing transcription activation. Probably not required in the steps following histone acetylation in processes of transcription activation. May be required for the mitotic checkpoint and normal cell cycle progression.confidentQ9Y4A5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0033276 [CC]transcription factor TFTC complexprobableGO:0030880, GO:0044464, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0000123, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043231, GO:0043234, GO:0032991, GO:0031981, GO:0043233, GO:0000428, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0070461, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0035267 [CC]NuA4 histone acetyltransferase complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0043189, GO:0005654, GO:0044451, GO:0043231, GO:0043234, GO:0032991, GO:0000123, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0030914 [CC]STAGA complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043231, GO:0043234, GO:0032991, GO:0000123, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0070461, GO:0044428, GO:0044424, GO:0044422
GO:0043967 [BP]histone H4 acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0018394, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0016568, GO:0016569
GO:0043968 [BP]histone H2A acetylationprobableGO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0018394, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0016568, GO:0016569
GO:0016578 [BP]histone deubiquitinationprobableGO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0070647, GO:0070646, GO:0016043, GO:0071704, GO:0016570, GO:0016579, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0005703 [CC]polytene chromosome puffprobableGO:0005575, GO:0043232, GO:0044464, GO:0005700, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0007093 [BP]mitotic cell cycle checkpointprobableGO:0007346, GO:0000075, GO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:1901987, GO:0010948, GO:0065007, GO:1901991, GO:1901990, GO:0048519, GO:0048523, GO:0050789, GO:1901988
GO:0016773 [MF]phosphotransferase activity, alcohol group as acceptorprobableGO:0016772, GO:0016740, GO:0003674, GO:0003824
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0090304 [BP]nucleic acid metabolic processprobableGO:0006139, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ABN, chain A
Confidence level:confident
Coverage over the Query: 33-131,143-171
View the alignment between query and template
View the model in PyMOL
Template: 3QKY, chain A
Confidence level:probable
Coverage over the Query: 3-169
View the alignment between query and template
View the model in PyMOL