Diaphorina citri psyllid: psy5943

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MVGINVLVDLLTLCHLHVSRATHVVQSNVLEAGSGPGLEDEEKEWYYGTSEQSKGPVTFHQIKHLWSTGELNPKTKVWAHGMESWKSLHQVPQLKWTLVAKNSGGVMNETELGCLILSMLTKVNLENKNTLGV
cccHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEECcccCCccccHHHHHHHHHccccccccEEEccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHHHcccccccccc
*VGINVLVDLLTLCHLHVSRATHVVQSNVLE********DEEKEWYYGTSEQSKGPVTFHQIKHLWSTGELNPKTKVWAHGMESWKSLHQVPQLKWTLVAKNSGGVMNETELGCLILSMLTKVNLENK*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGINVLVDLLTLCHLHVSRATHVVQSNVLEAGSGPGLEDEEKEWYYGTSEQSKGPVTFHQIKHLWSTGELNPKTKVWAHGMESWKSLHQVPQLKWTLVAKNSGGVMNETELGCLILSMLTKVNLENKNTLGV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DnaJ homolog subfamily C member 13 confidentO75165

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WH2, chain A
Confidence level:probable
Coverage over the Query: 39-96
View the alignment between query and template
View the model in PyMOL