Diaphorina citri psyllid: psy5948

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------55
MTLESQMNSLNMTSPSLSFDEKKQLITRNLQEFLGEDRLNVILKERDLKIYWGTATTGRPHIAYFVPMSKIADFLRAGCEVTILFADLHAYLDNMKAPWELLALRTKYYEESIKAMLESIDVPISKLKFVKGTDYQLSKEYTLDVYRLSSVITEHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTLAEKYLPQLGYAKRIHFMNPMVPGLAGGKMSSSEEDSKIDLLDAPALVKKKLKKAFCEPGNVEDNGVLSFLKHVVFSLLKPGENLVITRDENNGGNLNFSDYQSLEQVFAKQELHPADLKAAAEFYINRLLEPIRKKFESKELKDLTSKAYPPKKPVVESDIIAPHRLDIRVGKIVEVSRHPDAEALYVEKIDLGEENPRTIVSGLVNYVKEGDMANRLVVVLCNLKPAKMRGIESAGMVLCASVEEEGNKKVEPLFVPPSSKAGDKIVVEGYETGAPDEILNPKKKVWEKLQVDLKTSSEGIAQWQGFNIYWVPTLHFELWENFNENKSDNDTKLEDISGFSK
ccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHcccccEEEECccccccccccccHHHHHHHHHHcccEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccHHHccccccHHccCEEEcccccHHHHHHHHHHHHHccccccEEEcccccccccccccccccccccEEccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccEEEECccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccEEEEccccccccccccccEEEEEEcccccccccccccEEEEEEEEccccccEEEECccccccccccEEEEcccccccccccccccHHHHHHHccccEEcccEEEEEcccccccccccccccccccccccccccccEECcccccc
*********************KKQLITRNLQEFLGEDRLNVILKERDLKIYWGTATTGRPHIAYFVPMSKIADFLRAGCEVTILFADLHAYLDNMKAPWELLALRTKYYEESIKAMLESIDVPISKLKFVKGTDYQLSKEYTLDVYRLSSVITEHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTLAEKYLPQLGYAKRIHFMNPMVPG***************DLLDAPALVKKKLKKAFCEPGNVEDNGVLSFLKHVVFSLLKPGENLVITRDENNGGNLNFSDYQSLEQVFAKQELHPADLKAAAEFYINRLLEPIRKKFESKELKDLTSKAYPPKKPVVESDIIAPHRLDIRVGKIVEVSRHPDAEALYVEKIDLGEENPRTIVSGLVNYVKEGDMANRLVVVLCNLKPAKMRGIESAGMVLCASVEEEGNKKVEPLFVPPSSKAGDKIVVEGYETGAPDEILNPKKKVWEKLQVDLKTSSEGIAQWQGFNIYWVPTLHFELWENF********TKLEDISG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLESQMNSLNMTSPSLSFDEKKQLITRNLQEFLGEDRLNVILKERDLKIYWGTATTGRPHIAYFVPMSKIADFLRAGCEVTILFADLHAYLDNMKAPWELLALRTKYYEESIKAMLESIDVPISKLKFVKGTDYQLSKEYTLDVYRLSSVITEHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGVDQRKIFTLAEKYLPQLGYAKRIHFMNPMVPGLAGGKMSSSEEDSKIDLLDAPALVKKKLKKAFCEPGNVEDNGVLSFLKHVVFSLLKPGENLVITRDENNGGNLNFSDYQSLEQVFAKQELHPADLKAAAEFYINRLLEPIRKKFESKELKDLTSKAYPPKKPVVESDIIAPHRLDIRVGKIVEVSRHPDAEALYVEKIDLGEENPRTIVSGLVNYVKEGDMANRLVVVLCNLKPAKMRGIESAGMVLCASVEEEGNKKVEPLFVPPSSKAGDKIVVEGYETGAPDEILNPKKKVWEKLQVDLKTSSEGIAQWQGFNIYWVPTLHFELWENFNENKSDNDTKLEDISGFSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tyrosine--tRNA ligase, cytoplasmic Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).very confidentQ6TGS6
Tyrosine--tRNA ligase, cytoplasmic Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).very confidentQ5ZJ08
Tyrosine--tRNA ligase, cytoplasmic Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).very confidentP54577

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005153 [MF]interleukin-8 receptor bindingprobableGO:0005126, GO:0042379, GO:0003674, GO:0005488, GO:0005515, GO:0045236, GO:0001664, GO:0005102
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0004831 [MF]tyrosine-tRNA ligase activityprobableGO:0004812, GO:0003824, GO:0003674, GO:0016874, GO:0016875, GO:0016876
GO:0006437 [BP]tyrosyl-tRNA aminoacylationprobableGO:0006139, GO:0019752, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0034645, GO:0034660, GO:1901360, GO:0044267, GO:0044710, GO:0044260, GO:0006520, GO:0071704, GO:0010467, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0016070, GO:0044238, GO:1901564, GO:0006082, GO:0019538, GO:0044237, GO:0043170, GO:0006399, GO:0043038, GO:0043039, GO:0006418, GO:0006412
GO:0000049 [MF]tRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0004871 [MF]signal transducer activityprobableGO:0060089, GO:0003674

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.1.-.-1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase.probable
6.1.1.-Ligases forming aminoacyl-tRNA and related compounds.probable
6.1.1.1Tyrosine--tRNA ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N3L, chain A
Confidence level:very confident
Coverage over the Query: 16-357
View the alignment between query and template
View the model in PyMOL
Template: 1NTG, chain A
Confidence level:very confident
Coverage over the Query: 366-518
View the alignment between query and template
View the model in PyMOL