Diaphorina citri psyllid: psy594

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22

MLFVGGIPLFYMELALGQFHRKGAITCWGRIVPLFKGKMTRLARMASLTWPPALFIDGKYFNGLLSGVLVLTQHLNGNRYILEMQHSTGLHDLGYIKWDMALCLLAVYLICYFSMWKGISTSGKGIKYYLQPNFDAITKSEVSGDTSGPGLVFIVYPAAIATMPGSIFWSLIFFMMLLTLGLDSSFGGSEAIITALSDGLAMPRDELAGFRSEATEFS

cEEEEEEHHHHHHHHHHHHcccccHcHHHHHHHHccccEEEEEEEEHHHHHHHHHHccccccccccccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEECccccccEEccccccccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccEEEEEECc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003333 [BP]	amino acid transmembrane transport	probable	GO:0006810, GO:0006820, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0051179, GO:0071705, GO:0034220, GO:0044765, GO:0044763, GO:0071702, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0044699, GO:0046942
GO:0015171 [MF]	amino acid transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0046943
GO:0015804 [BP]	neutral amino acid transport	probable	GO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A65, chain A
Confidence level:very confident
Coverage over the Query: 2-210
View the alignment between query and template
View the model in PyMOL