Diaphorina citri psyllid: psy5970

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MKTILQSYLANFGYLEASSNSEIANLRTKEQVTEARFGNIPVTGIVDDATLALMKKPRCGLPDTPPLDRRRTKRFTLDGRKWDHTDLTWRVLSRVDSLIMKLLLRSVGNIVNSVNSSDFTQNKTRCYENLCGVEMQCQQGKFSLVSSLFKFLSQTKLVYSLINVPKPLV
cHHHHHHHHHHccccccccccccHHHHcHHHHHHHHHccccccccccHHHHHHHccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHccccEEEEccccccccCCcCEEEcccccccccccccccccccccEEEEcccccccc
MKTILQSYLANFGYLEA*****IANLRTKEQVTEARFGNIPVTGIVDDATLALMKKPRCGLPDTPPLDR**TKRFTLDGRKWDHTDLTWRVLSRVDSLIMKLLLRSVGNIVNSVNSSDFTQNKTRCYENLCGVEMQCQQGKFSLVSSLFKFLSQTKLVYSLINVPKPL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTILQSYLANFGYLEASSNSEIANLRTKEQVTEARFGNIPVTGIVDDATLALMKKPRCGLPDTPPLDRRRTKRFTLDGRKWDHTDLTWRVLSRVDSLIMKLLLRSVGNIVNSVNSSDFTQNKTRCYENLCGVEMQCQQGKFSLVSSLFKFLSQTKLVYSLINVPKPLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0070011 [MF]peptidase activity, acting on L-amino acid peptidesprobableGO:0016787, GO:0008233, GO:0003674, GO:0003824
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1L6J, chain A
Confidence level:very confident
Coverage over the Query: 3-21,33-160
View the alignment between query and template
View the model in PyMOL