Psyllid ID: psy5970

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MKTILQSYLANFGYLEASSNSEIANLRTKEQVTEARFGNIPVTGIVDDATLALMKKPRCGLPDTPPLDRRRTKRFTLDGRKWDHTDLTWRVLSRVDSLIMKLLLRSVGNIVNSVNSSDFTQNKTRCYENLCGVEMQCQQGKFSLVSSLFKFLSQTKLVYSLINVPKPLV
cHHHHHHHHHHcccccccccccHHHHHcHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHccccEEEEccccccccEEcEEEEcccccccccccccccccccccEEEEcccccccc
cHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHcccccccccccccccHcHHHEcccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEcccEEEEccccccEEEEccccccccccEEEccccEEEEEEEccccccc
MKTILQSYLANFgyleassnseiaNLRTKEQvtearfgnipvtgivDDATLAlmkkprcglpdtppldrrrtkrftldgrkwdhtdlTWRVLSRVDSLIMKLLLRSVGNivnsvnssdftqnktrcyenlcgvemqcqqgKFSLVSSLFKFLSQTKLVYSLINVPKPLV
MKTILQSYLANFGyleassnseiANLRTKEQvtearfgnipvtgiVDDATLALMKkprcglpdtppldrrrtkrftldgrkwdhtdltwrvlSRVDSLIMKLLLRSVGNivnsvnssdftqnKTRCYENLCGVEMQCQQGKFSLVSSLFKFLSqtklvyslinvpkplv
MKTILQSYLANFGYLEASSNSEIANLRTKEQVTEARFGNIPVTGIVDDATLALMKKPRCGLPDTPPLDRRRTKRFTLDGRKWDHTDLTWRVLSRVDSLIMKLLLRsvgnivnsvnssDFTQNKTRCYENLCGVEMQCQQGkfslvsslfkflsQTKLVYSLINVPKPLV
***ILQSYLANFGYLEA*****IANLRTKEQVTEARFGNIPVTGIVDDATLALMKKPRCGL**********TKRFTLDGRKWDHTDLTWRVLSRVDSLIMKLLLRSVGNIVNSVNSSDFTQNKTRCYENLCGVEMQCQQGKFSLVSSLFKFLSQTKLVYSLINV*****
MKTILQSYLANFGY*********************RFGNIPVTGIVDDATLALMKKPRCGLPDTPPLDR**********RKWDHTDLTWRVLSRVDSLIMKLLLRSVGNIVNSVNSSDFTQNKTRCYENLCGVEMQCQQGKFSLVSSLFKFLSQTKLVYSLINVPKPL*
MKTILQSYLANFGYLEASSNSEIANLRTKEQVTEARFGNIPVTGIVDDATLALMKKPRCGLPDTPPLDRRRTKRFTLDGRKWDHTDLTWRVLSRVDSLIMKLLLRSVGNIVNSVNSSDFTQNKTRCYENLCGVEMQCQQGKFSLVSSLFKFLSQTKLVYSLINVPKPLV
MKTILQSYLANFGYLEASSNSEIANLRTKEQVTEARFGNIPVTGIVDDATLALMKKPRCGLPDTPPLDRRRTKRFTLDGRKWDHTDLTWRVLSRVDSLIMKLLLRSVGNIVNSVNSSDFTQNKTRCYENLCGVEMQCQQGKFSLVSSLFKFLSQTKLVYSLINVPKPLV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTILQSYLANFGYLEASSNSEIANLRTKEQVTEARFGNIPVTGIVDDATLALMKKPRCGLPDTPPLDRRRTKRFTLDGRKWDHTDLTWRVLSRVDSLIMKLLLRSVGNIVNSVNSSDFTQNKTRCYENLCGVEMQCQQGKFSLVSSLFKFLSQTKLVYSLINVPKPLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
Q9R0S3 578 Matrix metalloproteinase- yes N/A 0.491 0.143 0.449 2e-15
Q9ULZ9 603 Matrix metalloproteinase- yes N/A 0.491 0.137 0.426 2e-14
Q9Y5R2 645 Matrix metalloproteinase- no N/A 0.502 0.131 0.402 4e-13
Q99PW6 618 Matrix metalloproteinase- no N/A 0.508 0.139 0.406 7e-13
Q9R0S2 618 Matrix metalloproteinase- no N/A 0.508 0.139 0.406 7e-13
P51511 669 Matrix metalloproteinase- no N/A 0.544 0.137 0.359 1e-11
Q9NPA2 562 Matrix metalloproteinase- no N/A 0.497 0.149 0.404 6e-11
O54732 657 Matrix metalloproteinase- no N/A 0.544 0.140 0.339 1e-10
P51512 607 Matrix metalloproteinase- no N/A 0.508 0.141 0.347 6e-09
Q9WTR0 607 Matrix metalloproteinase- no N/A 0.508 0.141 0.347 6e-09
>sp|Q9R0S3|MMP17_MOUSE Matrix metalloproteinase-17 OS=Mus musculus GN=Mmp17 PE=1 SV=3 Back     alignment and function desciption
 Score = 81.6 bits (200), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 40/89 (44%), Positives = 57/89 (64%), Gaps = 6/89 (6%)

Query: 8   YLANFGYLEASSNSEIANLRTKEQVTEA-----RFGNIPVTGIVDDATLALMKKPRCGLP 62
           +L+ FGYL  +  +    L+T+E++++A     +FG +  TGI+D+ATLALMK PRC LP
Sbjct: 54  WLSRFGYLPPADPAS-GQLQTQEELSKAITAMQQFGGLETTGILDEATLALMKTPRCSLP 112

Query: 63  DTPPLDRRRTKRFTLDGRKWDHTDLTWRV 91
           D PP  + R KR T    KW   +L+WRV
Sbjct: 113 DLPPGAQSRRKRQTPPPTKWSKRNLSWRV 141
Endopeptidase that degrades various components of the extracellular matrix, such as fibrin. May be involved in the activation of membrane-bound precursors of growth factors or inflammatory mediators, such as tumor necrosis factor-alpha. May also be involved in tumoral process. Not obvious if able to proteolytically activate progelatinase A. Does not hydrolyze collagen types I, II, III, IV and V, gelatin, fibronectin, laminin, decorin nor alpha1-antitrypsin.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|Q9ULZ9|MMP17_HUMAN Matrix metalloproteinase-17 OS=Homo sapiens GN=MMP17 PE=1 SV=4 Back     alignment and function description
>sp|Q9Y5R2|MMP24_HUMAN Matrix metalloproteinase-24 OS=Homo sapiens GN=MMP24 PE=2 SV=1 Back     alignment and function description
>sp|Q99PW6|MMP24_RAT Matrix metalloproteinase-24 OS=Rattus norvegicus GN=Mmp24 PE=2 SV=1 Back     alignment and function description
>sp|Q9R0S2|MMP24_MOUSE Matrix metalloproteinase-24 OS=Mus musculus GN=Mmp24 PE=1 SV=2 Back     alignment and function description
>sp|P51511|MMP15_HUMAN Matrix metalloproteinase-15 OS=Homo sapiens GN=MMP15 PE=1 SV=1 Back     alignment and function description
>sp|Q9NPA2|MMP25_HUMAN Matrix metalloproteinase-25 OS=Homo sapiens GN=MMP25 PE=1 SV=1 Back     alignment and function description
>sp|O54732|MMP15_MOUSE Matrix metalloproteinase-15 OS=Mus musculus GN=Mmp15 PE=2 SV=1 Back     alignment and function description
>sp|P51512|MMP16_HUMAN Matrix metalloproteinase-16 OS=Homo sapiens GN=MMP16 PE=1 SV=2 Back     alignment and function description
>sp|Q9WTR0|MMP16_MOUSE Matrix metalloproteinase-16 OS=Mus musculus GN=Mmp16 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
380013222 598 PREDICTED: matrix metalloproteinase-14-l 0.497 0.140 0.521 6e-19
350398989 645 PREDICTED: matrix metalloproteinase-15-l 0.497 0.130 0.521 2e-18
340719131 611 PREDICTED: matrix metalloproteinase-15-l 0.508 0.140 0.510 4e-18
328783162 419 PREDICTED: matrix metalloproteinase-25-l 0.497 0.200 0.521 1e-17
383861584 595 PREDICTED: matrix metalloproteinase-24-l 0.502 0.142 0.494 3e-17
270012816 701 matrix metalloproteinase 2 [Tribolium ca 0.526 0.126 0.473 4e-17
91089485 632 PREDICTED: similar to matrix metalloprot 0.526 0.140 0.473 4e-17
328721273 642 PREDICTED: matrix metalloproteinase-17-l 0.532 0.140 0.479 2e-16
242002936 566 conserved hypothetical protein [Pediculu 0.467 0.139 0.517 6e-16
30720736287 Matrix metalloproteinase-17 [Harpegnatho 0.461 0.896 0.511 5e-15
>gi|380013222|ref|XP_003690665.1| PREDICTED: matrix metalloproteinase-14-like [Apis florea] Back     alignment and taxonomy information
 Score = 99.0 bits (245), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 8/92 (8%)

Query: 5   LQSYLANFGYLEASSNSEIANLRTKEQVTEA-----RFGNIPVTGIVDDATLALMKKPRC 59
           +Q+YL  FGYL   S+ E  NLRT +Q+T+A     RFG IPVTG +D+AT+ LM+ PRC
Sbjct: 31  VQNYLMKFGYL-PQSDLETGNLRTDDQLTDAIKNLQRFGGIPVTGDIDEATMKLMRLPRC 89

Query: 60  GLPDT--PPLDRRRTKRFTLDGRKWDHTDLTW 89
           GLPD   P   R R KR+T+ G++W H +LTW
Sbjct: 90  GLPDKIDPRYTRVRHKRYTIHGQQWPHRNLTW 121

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350398989|ref|XP_003485375.1| PREDICTED: matrix metalloproteinase-15-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340719131|ref|XP_003398010.1| PREDICTED: matrix metalloproteinase-15-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328783162|ref|XP_001120736.2| PREDICTED: matrix metalloproteinase-25-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383861584|ref|XP_003706265.1| PREDICTED: matrix metalloproteinase-24-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|270012816|gb|EFA09264.1| matrix metalloproteinase 2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91089485|ref|XP_969495.1| PREDICTED: similar to matrix metalloproteinase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328721273|ref|XP_001945941.2| PREDICTED: matrix metalloproteinase-17-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242002936|ref|XP_002422548.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212505338|gb|EEB09810.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307207362|gb|EFN85112.1| Matrix metalloproteinase-17 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
MGI|MGI:1346076 578 Mmp17 "matrix metallopeptidase 0.491 0.143 0.449 6.7e-14
UNIPROTKB|I3L740 485 MMP17 "Uncharacterized protein 0.502 0.175 0.428 1.7e-13
ZFIN|ZDB-GENE-040724-262 606 mmp24 "matrix metallopeptidase 0.514 0.143 0.404 3.2e-13
UNIPROTKB|Q9ULZ9 603 MMP17 "Matrix metalloproteinas 0.491 0.137 0.426 6.7e-13
UNIPROTKB|F1NF49 571 MMP24 "Uncharacterized protein 0.514 0.152 0.414 1.6e-12
FB|FBgn0033438 758 Mmp2 "Matrix metalloproteinase 0.532 0.118 0.412 2e-12
UNIPROTKB|F1Q270 573 MMP24 "Uncharacterized protein 0.532 0.157 0.381 2.1e-12
UNIPROTKB|E1BH36 591 MMP17 "Uncharacterized protein 0.491 0.140 0.415 2.2e-12
ZFIN|ZDB-GENE-070820-2 597 mmp17a "matrix metallopeptidas 0.491 0.139 0.450 2.9e-12
MGI|MGI:1341867 618 Mmp24 "matrix metallopeptidase 0.508 0.139 0.406 3.1e-12
MGI|MGI:1346076 Mmp17 "matrix metallopeptidase 17" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 6.7e-14, P = 6.7e-14
 Identities = 40/89 (44%), Positives = 57/89 (64%)

Query:     8 YLANFGYLEASSNSEIANLRTKEQVTEA-----RFGNIPVTGIVDDATLALMKKPRCGLP 62
             +L+ FGYL  +  +    L+T+E++++A     +FG +  TGI+D+ATLALMK PRC LP
Sbjct:    54 WLSRFGYLPPADPAS-GQLQTQEELSKAITAMQQFGGLETTGILDEATLALMKTPRCSLP 112

Query:    63 DTPPLDRRRTKRFTLDGRKWDHTDLTWRV 91
             D PP  + R KR T    KW   +L+WRV
Sbjct:   113 DLPPGAQSRRKRQTPPPTKWSKRNLSWRV 141
GO:0004222 "metalloendopeptidase activity" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=IEA
GO:0005578 "proteinaceous extracellular matrix" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0008233 "peptidase activity" evidence=IEA
GO:0008237 "metallopeptidase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0031012 "extracellular matrix" evidence=IEA
GO:0031225 "anchored to membrane" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|I3L740 MMP17 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040724-262 mmp24 "matrix metallopeptidase 24" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULZ9 MMP17 "Matrix metalloproteinase-17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NF49 MMP24 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0033438 Mmp2 "Matrix metalloproteinase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q270 MMP24 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BH36 MMP17 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070820-2 mmp17a "matrix metallopeptidase 17a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1341867 Mmp24 "matrix metallopeptidase 24" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
pfam0147157 pfam01471, PG_binding_1, Putative peptidoglycan bi 1e-06
>gnl|CDD|216518 pfam01471, PG_binding_1, Putative peptidoglycan binding domain Back     alignment and domain information 
 Score = 43.3 bits (103), Expect = 1e-06
 Identities = 20/51 (39%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 5  LQSYLANFGYLEASSNSEIANLRTKEQVTEA-RFGNIPVTGIVDDATLALM 54
          LQ YL   GY     +       T+  V    RF  +PVTGIVD  TLA +
Sbjct: 8  LQRYLKRLGYYPGPVDGVFGP-STEAAVKAFQRFFGLPVTGIVDPETLAAL 57

This domain is composed of three alpha helices. This domain is found at the N or C terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally. Length = 57

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
KOG1565|consensus 469 100.0
cd04278157 ZnMc_MMP Zinc-dependent metalloprotease, matrix me 99.16
PF00413154 Peptidase_M10: Matrixin This Prosite motif covers 98.97
PF0147157 PG_binding_1: Putative peptidoglycan binding domai 98.38
smart00235140 ZnMc Zinc-dependent metalloprotease. Neutral zinc 97.43
cd04279156 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MM 97.12
cd04268165 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_ 96.05
cd04327 198 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MM 95.16
) family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01400">PF01400 191 Astacin: Astacin (Peptidase family M12A) This Pros 93.64
cd04276 197 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MM 92.84
TIGR02869201 spore_SleB spore cortex-lytic enzyme. Members of t 92.79
cd04280180 ZnMc_astacin_like Zinc-dependent metalloprotease, 92.06
cd04277186 ZnMc_serralysin_like Zinc-dependent metalloproteas 90.63
cd04281 200 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1 90.26
cd04282230 ZnMc_meprin Zinc-dependent metalloprotease, meprin 80.59
cd00203167 ZnMc Zinc-dependent metalloprotease. This super-fa 80.08
>KOG1565|consensus Back     alignment and domain information 
Probab=100.00  E-value=3e-36  Score=270.95  Aligned_cols=150  Identities=27%  Similarity=0.437  Sum_probs=126.8

Q ss_pred             HHHHHHHHHhcCCCCCCCCchhhccCCHHHHHH----h-HhcCCCccccCCHHHHHhhcCCCCCCCCCCCcccccccccc
Q psy5970           2 KTILQSYLANFGYLEASSNSEIANLRTKEQVTE----A-RFGNIPVTGIVDDATLALMKKPRCGLPDTPPLDRRRTKRFT   76 (169)
Q Consensus         2 ~~~~k~YL~kfGYL~~~~~~~~~~l~~~~~l~~----a-~f~gL~~TG~LD~~T~~~M~~PRCGvpD~~~~~~~r~~ry~   76 (169)
                      +..++.||++|||+.+ .+...... ++..+++    + ++++|++||++|.+|++.|++|||||||       ++++|+
T Consensus        30 ~~~~~~yl~~~~y~~~-~~~~~~~~-~~~~~~~al~~~q~~~~l~~tG~lD~~Tl~~m~~prCgvpd-------~~~~~~  100 (469)
T KOG1565|consen   30 KVALQDYLECYGYLPP-TDLTATRA-SQNVLEDALKMMQDFFGLPVTGKLDNATLALMNKPRCGVPD-------GRYRYF  100 (469)
T ss_pred             hhHHHHHhhhcccCCC-cccccccc-CchhhHHHHHhhhhhcCccccCCcchhhhhhccCCCcCCCC-------CccccC
Confidence            4678999999999988 44322211 3333444    4 9999999999999999999999999999       247899


Q ss_pred             cCCCccccccceeEEecCCchhhHHHHHHHhh---hhcccccccceEeccc----------ccccCCCCCCcccCCCeee
Q psy5970          77 LDGRKWDHTDLTWRVLSRVDSLIMKLLLRSVG---NIVNSVNSSDFTQNKT----------RCYENLCGVEMQCQQGKFS  143 (169)
Q Consensus        77 ~~~~kW~k~~LTYrI~nyt~dL~~~~v~rAf~---k~Ws~vt~L~Fte~~~----------~~~~Hgd~~pFDG~gG~la  143 (169)
                      ++++||+|++|||||.|||++|+..+|++|+.   ++|++|+||+|+|+..          ..++|||++||||+||+||
T Consensus       101 ~~~~kW~k~~lT~ri~n~~~~l~~~~vr~~~~~Af~~Ws~vtpl~f~e~~~~~~aDi~i~F~~~~h~d~~PFDG~~g~la  180 (469)
T KOG1565|consen  101 PGKPKWNKEHLTYRIKNYTPYLPQAEVRCAKSEAFKLWSDVTPLTFQEVKEEGEADIRISFFPGDHGDGFPFDGPGGVLA  180 (469)
T ss_pred             cccCcccccccceeccccCCCCCHHHHHHHHHHHHhhcccCCCCccccCCCCCCCceeeeeeccCCCCCCcccCCCCcee
Confidence            99999999999999999999999888765554   2799999999999975          2479999999999999999


Q ss_pred             ccc-------cccccccCcceEEE
Q psy5970         144 LVS-------SLFKFLSQTKLVYS  160 (169)
Q Consensus       144 ~~~-------~~~~~~~~~~~~~~  160 (169)
                      ||+       +-.|||++|.|+|.
T Consensus       181 HAf~Pg~~~~G~~hfD~dE~Wt~~  204 (469)
T KOG1565|consen  181 HAFFPGPGIGGDLHFDKDETWTYG  204 (469)
T ss_pred             cccCCCCCCCCccccCcccceecc
Confidence            983       46999999999995

>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>PF00413 Peptidase_M10: Matrixin This Prosite motif covers only the active site Back     alignment and domain information
>PF01471 PG_binding_1: Putative peptidoglycan binding domain; InterPro: IPR002477 This entry represents peptidoglycan binding domain (PGBD), as well as related domains that share the same structure Back     alignment and domain information
>smart00235 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information
>PF01400 Astacin: Astacin (Peptidase family M12A) This Prosite motif covers only the active site Back     alignment and domain information
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2 Back     alignment and domain information
>TIGR02869 spore_SleB spore cortex-lytic enzyme Back     alignment and domain information
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site Back     alignment and domain information
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily Back     alignment and domain information
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily Back     alignment and domain information
>cd00203 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
1ck7_A 631 Gelatinase A (Full-Length) Length = 631 9e-05
1slm_A255 Crystal Structure Of Fibroblast Stromelysin-1: The 2e-04
1su3_A 450 X-Ray Structure Of Human Prommp-1: New Insights Int 3e-04
1l6j_A 425 Crystal Structure Of Human Matrix Metalloproteinase 3e-04
1eak_A 421 Catalytic Domain Of Prommp-2 E404q Mutant Length = 8e-04
>pdb|1CK7|A Chain A, Gelatinase A (Full-Length) Length = 631 Back     alignment and structure 
Iteration: 1

 Score = 42.7 bits (99), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 6/63 (9%)
Query: 36  RFGNIPVTGIVDDATLALMKKPRCGLPDTPPLDRRRTKRFTLDGRKWDHTDLTWRVLSRV 95
           +F  +P TG +D  T+  M+KPRCG PD    +      F     KWD   +T+R++   
Sbjct: 50  KFFGLPQTGDLDQNTIETMRKPRCGNPDVANYN------FFPRKPKWDKNQITYRIIGYT 103
Query: 96  DSL 98
             L
Sbjct: 104 PDL 106
>pdb|1SLM|A Chain A, Crystal Structure Of Fibroblast Stromelysin-1: The C-Truncated Human Proenzyme Length = 255 Back     alignment and structure
>pdb|1SU3|A Chain A, X-Ray Structure Of Human Prommp-1: New Insights Into Collagenase Action Length = 450 Back     alignment and structure
>pdb|1L6J|A Chain A, Crystal Structure Of Human Matrix Metalloproteinase Mmp9 (gelatinase B) Length = 425 Back     alignment and structure
>pdb|1EAK|A Chain A, Catalytic Domain Of Prommp-2 E404q Mutant Length = 421 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 4e-20
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 2e-19
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 3e-18
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 1e-16
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 4e-16
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
 Score = 85.3 bits (210), Expect = 4e-20
 Identities = 24/100 (24%), Positives = 43/100 (43%), Gaps = 16/100 (16%)

Query: 4   ILQSYLANFGYLEASSNSEIANLRTKEQVTEA-----RFGNIPVTGIVDDATLALMKKPR 58
           + + YL  +GY   +           + +  A     +  ++P TG +D ATL  M+ PR
Sbjct: 25  LAEEYLYRYGYTRVAEMR-----GESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPR 79

Query: 59  CGLPDTPPLDRRRTKRFTLDGRKWDHTDLTWRVLSRVDSL 98
           CG+PD          +      KW H ++T+ + +  + L
Sbjct: 80  CGVPDLGR------FQTFEGDLKWHHHNITYWIQNYSEDL 113
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Length = 255 Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Length = 450 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Length = 631 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet fla 100.0
1eak_A 421 72 kDa type IV collagenase; hydrolase-hydrolase in 100.0
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease 100.0
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibrobl 100.0
1su3_A 450 Interstitial collagenase; prodomain, hemopexin dom 100.0
3ma2_D181 Matrix metalloproteinase-14; protein - protein com 99.89
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 99.84
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) 99.75
1k7i_A 479 PROC, secreted protease C; metalloprotease, hydrol 99.74
1kap_P 479 Alkaline protease; calcium binding protein, zinc m 99.73
2y6d_A174 Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapie 99.73
3ayu_A167 72 kDa type IV collagenase; protease, hydrolase-hy 99.72
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, viru 99.7
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, h 99.69
1y93_A159 Macrophage metalloelastase; matrix metalloproteina 99.68
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; memb 99.67
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex 99.67
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, 99.65
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease 99.64
1sat_A 471 Serratia protease; parallel beta helix, parallel b 99.62
3ba0_A 365 Macrophage metalloelastase; FULL-length MMP-12, he 99.6
1g9k_A 463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pse 99.57
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural 99.56
3edh_A201 Bone morphogenetic protein 1; vicinal disulfide, a 97.82
3lq0_A 235 Proastacin; metallopeptidase, zymogen activation, 97.56
1c7k_A132 NCNP, zinc endoprotease; alpha and beta protein, m 97.38
3lqb_A199 Hatching enzyme, LOC792177 protein; hydrolase, met 96.23
1lbu_A213 Muramoyl-pentapeptide carboxypeptidase; hydrolase, 94.0
3bkh_A268 Phikz144, lytic transglycosylase; bacteriophage, e 91.9
4fet_B222 Spore cortex-lytic enzyme prepeptide; transglycosy 88.85
3d2y_A261 N-acetylmuramoyl-L-alanine amidase AMID; zinc amid 88.19
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Back     alignment and structure
Probab=100.00  E-value=6.6e-44  Score=315.70  Aligned_cols=150  Identities=21%  Similarity=0.331  Sum_probs=120.3

Q ss_pred             HHHHHHHHhcCCCCCCCCchhhccCCHHHHHHh-HhcCCCccccCCHHHHHhhcCCCCCCCCCCCcccccccccccCCCc
Q psy5970           3 TILQSYLANFGYLEASSNSEIANLRTKEQVTEA-RFGNIPVTGIVDDATLALMKKPRCGLPDTPPLDRRRTKRFTLDGRK   81 (169)
Q Consensus         3 ~~~k~YL~kfGYL~~~~~~~~~~l~~~~~l~~a-~f~gL~~TG~LD~~T~~~M~~PRCGvpD~~~~~~~r~~ry~~~~~k   81 (169)
                      +++|+||++||||++ ...........++|++. +|+|||+||+||++|+++|++|||||||+.      .++++++++|
T Consensus        24 ~~a~~yL~~yGYl~~-~~~~~~~~~l~~Ai~~~Q~f~gL~vTG~LD~~T~~~M~~PRCGvpD~~------~~~~~~~~~k   96 (425)
T 1l6j_A           24 QLAEEYLYRYGYTRV-AEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLG------RFQTFEGDLK   96 (425)
T ss_dssp             HHHHHHHHHTTCC------------CHHHHHHHHHHHTCCCCSSCCHHHHHHHTSCBCSSCSSS------CSSCCSSCSS
T ss_pred             HHHHHHHHHcCCCCC-cccccchHHHHHHHHHHHHHcCCCCCCccCHHHHHHhcCCCCCCcccc------ccccccCCcc
Confidence            568999999999987 33211111123445555 999999999999999999999999999985      3456678899


Q ss_pred             cccccceeEEecCCchhhHHHH----HHHhhhhcccccccceEecccc---------cccCCCCCCcccCCCeeeccc--
Q psy5970          82 WDHTDLTWRVLSRVDSLIMKLL----LRSVGNIVNSVNSSDFTQNKTR---------CYENLCGVEMQCQQGKFSLVS--  146 (169)
Q Consensus        82 W~k~~LTYrI~nyt~dL~~~~v----~rAf~k~Ws~vt~L~Fte~~~~---------~~~Hgd~~pFDG~gG~la~~~--  146 (169)
                      |+|++|||+|.||+++|+.++|    ++||+ +||+|+||+|+|+..+         .++|||++||||+||+||||.  
T Consensus        97 W~k~~LTY~i~~~t~~l~~~~v~~~i~~Af~-~Ws~vt~L~F~ev~~~~ADI~I~F~~g~HgD~~pFDG~gg~LAHAf~P  175 (425)
T 1l6j_A           97 WHHHNITYWIQNYSEDLPRAVIDDAFARAFA-LWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPP  175 (425)
T ss_dssp             CCSSEEEEEECCCCTTSCHHHHHHHHHHHHH-HHHHTSSCEEEEECSTTSSEEEEEECSSCSSSCCCCSTTSBCEEECCS
T ss_pred             cccceeEEEEecCCCCCCHHHHHHHHHHHHH-HHhhcccceEEEccCCCCCEEEEEeeccCCCcccccCCCcccccccCC
Confidence            9999999999999999986654    56666 8999999999998643         578999999999999999995  


Q ss_pred             -----cccccccCcceEEE
Q psy5970         147 -----SLFKFLSQTKLVYS  160 (169)
Q Consensus       147 -----~~~~~~~~~~~~~~  160 (169)
                           +-.|||++|.|+..
T Consensus       176 ~~g~~Gd~HFD~dE~Wt~~  194 (425)
T 1l6j_A          176 GPGIQGDAHFDDDELWSLG  194 (425)
T ss_dssp             SSTTTTCEEEETTSCEESS
T ss_pred             CCCCCCceeeeeccccccC
Confidence                 34999999999864
>1eak_A 72 kDa type IV collagenase; hydrolase-hydrolase inhibitor complex, hydrolyse, matrix metalloproteinase, gelatinase A, hydrolase- hydrolase inhib complex; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} SCOP: d.92.1.11 PDB: 1bqq_M 1buv_M Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 4a7b_A* 3tvc_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 2yig_A* 3elm_A* 3i7g_A* 3i7i_A* 3zxh_A* 2ow9_A* 2ozr_A* 3kek_A* 3kej_A* 3kec_A* 2d1n_A* 1fls_A* ... Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP-9) type IV collagenase) (92 kDa gelatinase)...; S1-prime pocket, hydrolase-hydrola inhibitor complex; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Back     alignment and structure
>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Back     alignment and structure
>2y6d_A Matrilysin; hydrolase; HET: TQJ; 1.60A {Homo sapiens} PDB: 2ddy_A* 1mmq_A* 1mmp_A* 1mmr_A* 2y6c_A* Back     alignment and structure
>3ayu_A 72 kDa type IV collagenase; protease, hydrolase-hydrolase inhibitor complex; 2.00A {Homo sapiens} PDB: 1qib_A 1hov_A* Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase inhibitor), acetohydroxamic acid, hydrola; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 3lik_A* 3lil_A* 3lir_A* 3ljg_A* 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* ... Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrol; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 3oho_A* 1ciz_A* ... Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* 3shi_A Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A* 1smp_A 1srp_A Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Back     alignment and structure
>3edh_A Bone morphogenetic protein 1; vicinal disulfide, alternative splicing, calcium, chondrogenesis, cleavage on PAIR of basic residues, cytokine; 1.25A {Homo sapiens} SCOP: d.92.1.0 PDB: 3edg_A 3edi_A Back     alignment and structure
>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, D bond, hydrolase, metal-binding, metalloprotease, zymogen; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A Back     alignment and structure
>1c7k_A NCNP, zinc endoprotease; alpha and beta protein, metalloproteinase, hydrolase; 1.00A {Streptomyces caespitosus} SCOP: d.92.1.1 PDB: 1kuh_A Back     alignment and structure
>3lqb_A Hatching enzyme, LOC792177 protein; hydrolase, metalloprotease, astacin, metal- protease; 1.10A {Danio rerio} Back     alignment and structure
>1lbu_A Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus} SCOP: a.20.1.1 d.65.1.1 Back     alignment and structure
>3bkh_A Phikz144, lytic transglycosylase; bacteriophage, endolysin, peptidoglycan, cell WALL degradation, lysozyme, hydrolase; 2.50A {Pseudomonas phage phikz} PDB: 3bkv_A* Back     alignment and structure
>4fet_B Spore cortex-lytic enzyme prepeptide; transglycosylase, cortex hydrolase domain, sodium ION, seMet hydrolase; 1.91A {Bacillus anthracis} Back     alignment and structure
>3d2y_A N-acetylmuramoyl-L-alanine amidase AMID; zinc amidase, PGRP, peptidoglycan recognizing protein, AMPD, acetylmuramyl-L-alanine amidase; HET: AH0; 1.75A {Escherichia coli} PDB: 2bh7_A 2wkx_A 2bgx_A* 3d2z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 169
d1su3a167 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) 7e-18
d1slma165 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (H 6e-17
d1l6ja177 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (H 4e-15
d1eaka176 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (H 2e-13
d1hv5a_162 d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus 7e-04
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure

class: All alpha proteins
fold: PGBD-like
superfamily: PGBD-like
family: MMP N-terminal domain
domain: Fibroblast collagenase (MMP-1)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 71.3 bits (175), Expect = 7e-18
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 4  ILQSYLANFGYLEASSNSEIANLRTKEQVTEA-----RFGNIPVTGIVDDATLALMKKPR 58
          ++Q YL  +  L+ +   ++   R    V E       F  + VTG  D  TL +MK+PR
Sbjct: 2  LVQKYLEKYYNLK-NDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPR 60

Query: 59 CGLPD 63
          CG+PD
Sbjct: 61 CGVPD 65
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d1su3a167 Fibroblast collagenase (MMP-1) {Human (Homo sapien 99.9
d1slma165 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 99.89
d1l6ja177 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 99.86
d1eaka176 Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 99.84
d1mmqa_166 Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9 99.25
d1hv5a_162 Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxI 99.23
d1xuca1169 Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxI 99.07
d1i76a_163 Neutrophil collagenase (MMP-8) {Human (Homo sapien 99.01
d1hy7a_168 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibro 98.97
d1hfca_157 Fibroblast collagenase (MMP-1) {Human (Homo sapien 98.92
d2ovxa1159 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 98.85
d1k7ia2241 Metalloprotease {Erwinia chrysanthemi [TaxId: 556] 98.81
d1kapp2246 Metalloprotease {Pseudomonas aeruginosa [TaxId: 28 98.8
d1y93a1158 Macrophage elastase (MMP-12) {Human (Homo sapiens) 98.78
d1qiba_161 Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1sata2243 Metalloprotease {Serratia marcescens [TaxId: 615]} 98.71
d1rm8a_169 Matrix metalloproteinase-16 (MMP-16) {Human (Homo 98.64
d1bqqm_174 Membrane-type matrix metalloproteinase (CDMT1-MMP) 98.55
d1g9ka2242 Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId 98.24
d1lbua183 Zn2+ DD-carboxypeptidase, N-terminal domain {Strep 96.29
d2bgxa181 Probable N-acetylmuramoyl-L-alanine amidase YbjR, 90.5
d1asta_ 200 Astacin {European fresh water crayfish (Astacus as 90.06
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: PGBD-like
superfamily: PGBD-like
family: MMP N-terminal domain
domain: Fibroblast collagenase (MMP-1)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.90  E-value=3.1e-25  Score=149.34  Aligned_cols=62  Identities=35%  Similarity=0.641  Sum_probs=45.6

Q ss_pred             HHHHHHHHhcCCCCCCCCchhhccCCHHHHHHh-----HhcCCCccccCCHHHHHhhcCCCCCCCCCC
Q psy5970           3 TILQSYLANFGYLEASSNSEIANLRTKEQVTEA-----RFGNIPVTGIVDDATLALMKKPRCGLPDTP   65 (169)
Q Consensus         3 ~~~k~YL~kfGYL~~~~~~~~~~l~~~~~l~~a-----~f~gL~~TG~LD~~T~~~M~~PRCGvpD~~   65 (169)
                      |.+|+||++||||++ .+...+...+.+++++|     +|+||++||+||++|+++|++|||||||+.
T Consensus         1 ~l~~~YL~~fgyl~~-~~~~~~~~~~~~~~~~Aik~fQ~f~~L~~TG~lD~~T~~~M~~PRCGvpDva   67 (67)
T d1su3a1           1 DLVQKYLEKYYNLKN-DGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVA   67 (67)
T ss_dssp             CHHHHHHHHHSCCC-------------CHHHHHHHHHHHHTTCCCCSSCCHHHHHHHTSCBCSSCSCC
T ss_pred             CHHHHHHHHhCCCCC-CccccccccchHHHHHHHHHHHHHcCCCcccccCHHHHHHHCCCCCCCCCCC
Confidence            579999999999987 54444444445556666     999999999999999999999999999973
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mmqa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv5a_ d.92.1.11 (A:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xuca1 d.92.1.11 (A:104-272) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i76a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hy7a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1hfca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovxa1 d.92.1.11 (A:110-443) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ia2 d.92.1.6 (A:18-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1kapp2 d.92.1.6 (P:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y93a1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qiba_ d.92.1.11 (A:) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1rm8a_ d.92.1.11 (A:) Matrix metalloproteinase-16 (MMP-16) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqqm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]} Back     information, alignment and structure
>d1lbua1 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyces albus G [TaxId: 1962]} Back     information, alignment and structure
>d2bgxa1 a.20.1.1 (A:180-260) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1asta_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]} Back     information, alignment and structure