Diaphorina citri psyllid: psy597

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540------

MTKTLNEYRVKKIESIGKMTVMNQEEIMTNTKTVQQGLEALKNEHTSILNSLSETQHGGPVEEEKRNMVKNSLEIIELGLNEAQVMTALAGHLQNVEAEKQKLRTQVRRLVQENAWLRDELANTQQKLQSSEQANSQLEEEKKHLEFMSSIRKYDSDIQGDENSGDQKSDKHKQDDPVVDLFPDEDNDDRNNLSPTPPSQFAQQVNAGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGKYEAAETLEDCALRSRKESYDIVKQAKVAQILGSGGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALTIREKTLGENHAAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKEHPDVAKQLNNLALLCQNQSKYEEVERYYQRALEIYELKLGPDDSNVAKTKNNLASCYLKQGKYKEAEILYKQVLTRAHEREFGACDGDNKPIWQDRQKNKAKNREKYYQRALEIYELKLGPDDSNVAKTKNNLASCYLKQGKYKEAEILYKQVLTRAHEREFGACDGDNKPIWQ

ccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccc

*********************MNQEEIMTNTKTVQQGLEALKNEHTSILNSLSETQHGGPVEEEKRNMVKNSLEIIELGLNEAQVMTALAGHLQNVEAEKQKLRTQVRRLVQENAWLRDELANTQQKLQSSEQANSQLEEEKKHLEFMSSIRKYDSDIQG*****DQKSDKHKQDDPVVDLFPDEDNDDRNNLSPTPPSQFAQQVNAGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGKYEAAETLEDCALRSRKESYDIVKQAKVAQILGSGGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALTIREKTLGENHAAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKEHPDVAKQLNNLALLCQNQSKYEEVERYYQRALEIYELKLGPDDSNVAKTKNNLASCYLKQGKYKEAEILYKQVLTRAHEREFGACDGDNKPIWQDRQKNKAKNREKYYQRALEIYELKLGPDDSNVAKTKNNLASCYLKQGKYKEAEILYKQVLTRAHEREFGACD****P***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MTKTLNEYRVKKIESIGKMTVMNQEEIMTNTKTVQQGLEALKNEHTSILNSLSETQHGGPVEEEKRNMVKNSLEIIELGLNEAQVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSSIRKYDSDIQGDENSGDQKSDKHKQDDPVVDLFPDEDNDDRNNLSPTPPSQFAQQVNAGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGKYEAAETLEDCALRSRKESYDIVKQAKVAQILGSGGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALTIREKTLGENHAAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKEHPDVAKQLNNLALLCQNQSKYEEVERYYQRALEIYELKLGPDDSNVAKTKNNLASCYLKQGKYKEAEILYKQVLTRAHEREFGACDGDNKPIWQDRQKNKAKNREKYYQRALEIYELKLGPDDSNVAKTKNNLASCYLKQGKYKEAEILYKQVLTRAHEREFGACDGDNKPIWQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Kinesin light chain 1	Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity.	very confident	Q5R581
Kinesin light chain	Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity.	very confident	P46822
Kinesin light chain	Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity.	very confident	P46824

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007596 [BP]	blood coagulation	probable	GO:0032501, GO:0007599, GO:0044707, GO:0050878, GO:0050896, GO:0009611, GO:0042060, GO:0006950, GO:0050817, GO:0008150, GO:0065007, GO:0065008, GO:0044699
GO:0035418 [BP]	protein localization to synapse	probable	GO:0033036, GO:0008104, GO:0008150, GO:0051179
GO:0006886 [BP]	intracellular protein transport	probable	GO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0003777 [MF]	microtubule motor activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774
GO:0019886 [BP]	antigen processing and presentation of exogenous peptide antigen via MHC class II	probable	GO:0002504, GO:0019882, GO:0019884, GO:0002478, GO:0002495, GO:0002376, GO:0008150, GO:0048002
GO:0005871 [CC]	kinesin complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422
GO:0005874 [CC]	microtubule	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0008088 [BP]	axon cargo transport	probable	GO:0051234, GO:0007017, GO:0046907, GO:0006810, GO:0007018, GO:0006928, GO:0044765, GO:0010970, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0030705, GO:0051179, GO:0044699, GO:0051641
GO:0019894 [MF]	kinesin binding	probable	GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0035617 [BP]	stress granule disassembly	probable	GO:0071826, GO:0043933, GO:0071840, GO:0009987, GO:0032984, GO:0032988, GO:0008150, GO:0022411, GO:0016043, GO:0044763, GO:0044699
GO:0035253 [CC]	ciliary rootlet	probable	GO:0005856, GO:0005575, GO:0043228, GO:0043231, GO:0043232, GO:0031514, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0044422, GO:0044441
GO:0005635 [CC]	nuclear envelope	probable	GO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0008017 [MF]	microtubule binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0031410 [CC]	cytoplasmic vesicle	probable	GO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NF1, chain A
Confidence level:very confident
Coverage over the Query: 204-249,286-477,495-530
View the alignment between query and template
View the model in PyMOL

Template: 4A1S, chain A
Confidence level:very confident
Coverage over the Query: 211-529
View the alignment between query and template
View the model in PyMOL

Template: 4G1T, chain A
Confidence level:very confident
Coverage over the Query: 122-157,208-249,286-530
View the alignment between query and template
View the model in PyMOL

Template: 2GW1, chain A
Confidence level:very confident
Coverage over the Query: 120-163,174-533
View the alignment between query and template
View the model in PyMOL

Template: 3HNW, chain A
Confidence level:probable
Coverage over the Query: 82-145
View the alignment between query and template
View the model in PyMOL