Diaphorina citri psyllid: psy5981


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MSFKSVTVETKVFDGQKPGTSGLRKPTKTFQQEHYTENFIQSILTALGDKLKGSVLVVGGDGRYFGDVAVDKIIKISAANGVAKLIVGQNGILSTPAVSALIRKHILGRLVKVPSSNPSRTIRPCPLLITK
cccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHccccEEEEccccccccccccccccccc
****SVT*ETKVFDGQKPGTSGLRKPTKTFQQEHYTENFIQSILTALGDKLKGSVLVVGGDGRYFGDVAVDKIIKISAANGVAKLIVGQNGILSTPAVSALIRKHILGRLVKVPSSNPSRTIRP*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFKSVTVETKVFDGQKPGTSGLRKPTKTFQQEHYTENFIQSILTALGDKLKGSVLVVGGDGRYFGDVAVDKIIKISAANGVAKLIVGQNGILSTPAVSALIRKHILGRLVKVPSSNPSRTIRPCPLLITK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphoglucomutase-1 This enzyme participates in both the breakdown and synthesis of glucose.confidentQ23919
Probable phosphoglucomutase This enzyme participates in both the breakdown and synthesis of glucose.confidentO74374
Phosphoglucomutase This enzyme participates in both the breakdown and synthesis of glucose.confidentP57749

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016868 [MF]intramolecular transferase activity, phosphotransferasesprobableGO:0016866, GO:0003674, GO:0016853, GO:0003824
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044422 [CC]organelle partprobableGO:0005575, GO:0043226
GO:0019320 [BP]hexose catabolic processprobableGO:0044238, GO:1901575, GO:0019318, GO:0046365, GO:0005996, GO:0016052, GO:0071704, GO:0008150, GO:0008152, GO:0044723, GO:0005975, GO:0009056, GO:0044724
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005992 [BP]trehalose biosynthetic processprobableGO:0071704, GO:0046351, GO:0044238, GO:0044262, GO:0044249, GO:0009311, GO:0009987, GO:0005984, GO:0005991, GO:0016051, GO:0034637, GO:0009058, GO:0008150, GO:0044237, GO:0008152, GO:1901576, GO:0044723, GO:0005975, GO:0009312
GO:0006006 [BP]glucose metabolic processprobableGO:0044238, GO:0005975, GO:0005996, GO:0019318, GO:0071704, GO:0008150, GO:0008152, GO:0044723
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0048046 [CC]apoplastprobableGO:0005575, GO:0005576
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0006011 [BP]UDP-glucose metabolic processprobableGO:0034641, GO:0006807, GO:0044281, GO:1901360, GO:0006139, GO:0044710, GO:0071704, GO:0009225, GO:0009987, GO:0006725, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901135, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005978 [BP]glycogen biosynthetic processprobableGO:0044249, GO:0009250, GO:0034645, GO:0006091, GO:0016051, GO:1901576, GO:0044264, GO:0044262, GO:0044260, GO:0071704, GO:0006112, GO:0006073, GO:0043170, GO:0009987, GO:0000271, GO:0044710, GO:0034637, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0044723, GO:0055114, GO:0044042, GO:0044238, GO:0005975, GO:0015980, GO:0005977, GO:0005976, GO:0044237, GO:0033692

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KFI, chain A
Confidence level:very confident
Coverage over the Query: 6-123
View the alignment between query and template
View the model in PyMOL