Diaphorina citri psyllid: psy5990


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MNTVAGVISLLDDPMIELKEFSLKKLNDIVDDFWPEVSEAIQKIEILHEDKGFPQYKLAALVASKVYFHLGSFSDSLQYALGAGDLFDVRNDTVYVKTIICKYFCISLSTYRYSNVQIF
cccHHHHHHHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccccc
*NTVAGVISLLDDPMIELKEFSLKKLNDIVDDFWPEVSEAIQKIEILHEDKGFPQYKLAALVASKVYFHLGSFSDSLQYALGAGDLFDVRNDTVYVKTIICKYFCISLSTYRYSN****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTVAGVISLLDDPMIELKEFSLKKLNDIVDDFWPEVSEAIQKIEILHEDKGFPQYKLAALVASKVYFHLGSFSDSLQYALGAGDLFDVRNDTVYVKTIICKYFCISLSTYRYSNVQIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
26S proteasome non-ATPase regulatory subunit 1 Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.confidentQ9V3P6
26S proteasome non-ATPase regulatory subunit 1 Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.confidentQ5F418
26S proteasome non-ATPase regulatory subunit 1 Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.confidentO88761

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022624 [CC]proteasome accessory complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0000502
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004175 [MF]endopeptidase activityprobableGO:0016787, GO:0008233, GO:0070011, GO:0003674, GO:0003824

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ADY, chain A
Confidence level:very confident
Coverage over the Query: 12-114
View the alignment between query and template
View the model in PyMOL