Diaphorina citri psyllid: psy5991


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MLEEWLNHYRRLQTKTSISRLTSKYFVCFFSEIENLPPSIQEQLFDELLDKEAQQQLEAEPHPVINWSHELLDKEAQQQLEAEPHPVINWSHEVTAHLYALWNRSAGDCLLDSLMQATWGVFDRENVLRRALADSLAQASHLFYPRWKEYEDMHASLLHFSLDESQWEEDWASLVSLASQPGAALEQLHVFALAHILRRPIIVYGVKYVKSFRGEDIGYARFE
cHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccccccccccEEEEEEcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccEEEEEEEEEEccccccccccccc
*LEEWLNHYRRLQTKTSISRLTSKYFVCFFSEIENLPPSIQEQLFDELLDKEAQQ*LE***HPVINWSHELLDKEAQQQLEAEPHPVINWSHEVTAHLYALWNRSAGDCLLDSLMQATWGVFDRENVLRRALADSLAQASHLFYPRWKEYEDMHASLLHFSLDESQWEEDWASLVSLASQPGAALEQLHVFALAHILRRPIIVYGVKYVKSFRGEDIGYA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEEWLNHYRRLQTKTSISRLTSKYFVCFFSEIENLPPSIQEQLFDELLDKEAQQQLEAEPHPVINWSHELLDKEAQQQLEAEPHPVINWSHEVTAHLYALWNRSAGDCLLDSLMQATWGVFDRENVLRRALADSLAQASHLFYPRWKEYEDMHASLLHFSLDESQWEEDWASLVSLASQPGAALEQLHVFALAHILRRPIIVYGVKYVKSFRGEDIGYARFE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin thioesterase ZRANB1 Positive regulator of the Wnt signaling pathway that specifically cleaves 'Lys-63'-linked ubiquitin chains. Acts by deubiquitinating APC protein, a negative regulator of Wnt-mediated transcription. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. May also modulate TNF-alpha signaling.confidentQ9UGI0
Ubiquitin thioesterase Zranb1 Positive regulator of the Wnt signaling pathway that specifically cleaves 'Lys-63'-linked ubiquitin chains. Acts by deubiquitinating APC protein, a negative regulator of Wnt-mediated transcription. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. May also modulate TNF-alpha signaling.confidentQ7M760
Ubiquitin thioesterase ZRANB1 Positive regulator of the Wnt signaling pathway that specifically cleaves 'Lys-63'-linked ubiquitin chains. Acts by deubiquitinating APC protein, a negative regulator of Wnt-mediated and cell migration. transcription. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. May also modulate TNF-alpha signaling.confidentA6QP16

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030177 [BP]positive regulation of Wnt receptor signaling pathwayprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0030111, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0004843 [MF]ubiquitin-specific protease activityprobableGO:0016787, GO:0019783, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0070530 [MF]K63-linked polyubiquitin bindingprobableGO:0032182, GO:0043130, GO:0003674, GO:0005488, GO:0005515, GO:0031593
GO:0070536 [BP]protein K63-linked deubiquitinationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0016579
GO:0022603 [BP]regulation of anatomical structure morphogenesisprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZRH, chain A
Confidence level:very confident
Coverage over the Query: 21-61,86-223
View the alignment between query and template
View the model in PyMOL