Diaphorina citri psyllid: psy6014


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------7
MGNSTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFSRYSTGWKCGLHADWTELTSCVHSSG
cccccccHHHHHcccccccccccccccEEEEEcccccccEEEEEEccccccccccccHHHHcccccccc
*****SFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFSRYSTGWKCGLHADWTELTSCVH***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNSTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFSRYSTGWKCGLHADWTELTSCVHSSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heparan-sulfate 6-O-sulfotransferase 1 6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.confidentO60243
Heparan-sulfate 6-O-sulfotransferase 1 6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate. Also transfers sulfate to CDSNS-heparin and performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact).confidentQ91ZB4
Heparan-sulfate 6-O-sulfotransferase 1-A 6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.confidentQ56UJ5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0008587 [BP]imaginal disc-derived wing margin morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0015012 [BP]heparan sulfate proteoglycan biosynthetic processprobableGO:0030201, GO:0044249, GO:0044281, GO:0034645, GO:0009100, GO:0009101, GO:1901576, GO:0044710, GO:0044260, GO:0071704, GO:0009987, GO:0030166, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0043436, GO:0044238, GO:0006082, GO:0044272, GO:1901137, GO:1901135, GO:0044237, GO:0043170, GO:0019538, GO:0006029, GO:0006790
GO:0060828 [BP]regulation of canonical Wnt receptor signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0030111, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0008543 [BP]fibroblast growth factor receptor signaling pathwayprobableGO:0007166, GO:0007167, GO:0070848, GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0007169, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0044344, GO:0071310, GO:0065007, GO:0071495, GO:0009987, GO:0050794, GO:0044763, GO:0007154, GO:0010033, GO:0044700, GO:0071363, GO:0050896, GO:0071774, GO:0008150
GO:0007428 [BP]primary branching, open tracheal systemprobableGO:0032502, GO:0048754, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0060541, GO:0032501, GO:0035239, GO:0060446, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0007424, GO:0044707, GO:0048856, GO:0048731
GO:0090097 [BP]regulation of decapentaplegic signaling pathwayprobableGO:0090092, GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0017095 [MF]heparan sulfate 6-O-sulfotransferase activityprobableGO:0016782, GO:0008146, GO:0003824, GO:0016740, GO:0003674, GO:0034483
GO:0022416 [BP]chaeta developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0045570 [BP]regulation of imaginal disc growthprobableGO:0048638, GO:0046620, GO:0040008, GO:0008150, GO:0050793, GO:2000026, GO:0051239, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted