Diaphorina citri psyllid: psy6063


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MSRLRNLYEALSRKKIDVGDDDVSIAEGKNPAGGADGVGKLPLERASDAPQLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVIIL
ccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccEEccEEEEEEHHHHHHccccHHHHHHHHHHHHHHHHHHcc
***********SR*************************************QLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVIIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRLRNLYEALSRKKIDVGDDDVSIAEGKNPAGGADGVGKLPLERASDAPQLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVIIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cationic amino acid transporter 3 Mediates the uptake of the cationic amino acids arginine, lysine and ornithine in a sodium-independent manner.confidentP70423
Cationic amino acid transporter 3 Mediates the uptake of the cationic amino acids arginine, lysine and ornithine in a sodium-independent manner.confidentQ8WY07
Low affinity cationic amino acid transporter 2 Low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine).confidentB3TP03

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0006629 [BP]lipid metabolic processprobableGO:0044238, GO:0044710, GO:0008150, GO:0008152, GO:0071704
GO:0003333 [BP]amino acid transmembrane transportprobableGO:0006810, GO:0006820, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0051179, GO:0071705, GO:0034220, GO:0044765, GO:0044763, GO:0071702, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0044699, GO:0046942
GO:0032006 [BP]regulation of TOR signaling cascadeprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0015819 [BP]lysine transportprobableGO:0006810, GO:0006820, GO:0071702, GO:0006812, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0044765, GO:0008150, GO:0015802, GO:0015849, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0015189 [MF]L-lysine transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0015075, GO:0022857, GO:0003674, GO:0015179, GO:0015174, GO:0015171, GO:0046943
GO:0015822 [BP]ornithine transportprobableGO:0006810, GO:0006820, GO:0071702, GO:0006812, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0044765, GO:0008150, GO:0015849, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0009705 [CC]plant-type vacuole membraneprobableGO:0005737, GO:0005575, GO:0000325, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000064 [MF]L-ornithine transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0015075, GO:0022857, GO:0003674, GO:0015179, GO:0015171, GO:0046943
GO:0010923 [BP]negative regulation of phosphatase activityprobableGO:0051336, GO:0019220, GO:0051346, GO:0019222, GO:0065009, GO:0010921, GO:0050790, GO:0031323, GO:0050789, GO:0051174, GO:0065007, GO:0044092, GO:0008150, GO:0035303, GO:0050794, GO:0043086
GO:0034641 [BP]cellular nitrogen compound metabolic processprobableGO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237
GO:0015807 [BP]L-amino acid transportprobableGO:0006810, GO:0044765, GO:0015849, GO:0006811, GO:0006865, GO:0015711, GO:0071705, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0040007 [BP]growthprobableGO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005289 [MF]high affinity arginine transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0008324, GO:0005287, GO:0015075, GO:0022857, GO:0003674, GO:0015174, GO:0015181, GO:0015171, GO:0046943

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 53-108
View the alignment between query and template
View the model in PyMOL