Psyllid ID: psy6063


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MSRLRNLYEALSRKKIDVGDDDVSIAEGKNPAGGADGVGKLPLERASDAPQLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVIIL
ccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccEEccEEEEEEHHHHHHccccHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHccccccccccccccccccHHHHHHHEEEccccccccccHHHHHHcHHHHHEEcccHHccccEEEEEHHHHHHcccHHHHHHHHHHHHHHHHHHHHc
MSRLRNLYEALSrkkidvgdddvsiaegknpaggadgvgklplerasdapQLARVLGLIDLTMLGVGATLGVGVYVLAGsvarnqagpsVVISFAIAAVTSLFSVIIL
MSRLRNLYEalsrkkidvgdddvsiaegknpaggadgvGKLPLERASDAPQLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVIIL
MSRLRNLYEALSRKKIDVGDDDVSIAEGKNPAGGADGVGKLPLERASDAPQLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVIIL
**************************************************QLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVII*
***********SR*******************************************GLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVIIL
MSRLRNLYEALSRKKIDVGDDDVSIAEGKNPAGGADGVGKLPLERASDAPQLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVIIL
*****N**EALSR*********************ADGVGKLPLERASDAPQLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVIIL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRLRNLYEALSRKKIDVGDDDVSIAEGKNPAGGADGVGKLPLERASDAPQLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVIIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query108 2.2.26 [Sep-21-2011]
P70423 618 Cationic amino acid trans yes N/A 0.574 0.100 0.548 1e-11
O08812 619 Cationic amino acid trans yes N/A 0.574 0.100 0.548 1e-11
Q8WY07 619 Cationic amino acid trans yes N/A 0.638 0.111 0.521 3e-11
Q09143 622 High affinity cationic am no N/A 0.629 0.109 0.506 5e-11
Q5PR34 640 Low affinity cationic ami no N/A 0.5 0.084 0.574 7e-11
P30825 629 High affinity cationic am no N/A 0.527 0.090 0.578 7e-11
P30823 624 High affinity cationic am no N/A 0.527 0.091 0.578 9e-11
Q6DCE8 622 Low affinity cationic ami N/A N/A 0.546 0.094 0.525 4e-10
B3TP03 654 Low affinity cationic ami yes N/A 0.472 0.077 0.607 4e-10
A8I499 657 Low affinity cationic ami no N/A 0.481 0.079 0.596 5e-10
>sp|P70423|CTR3_MOUSE Cationic amino acid transporter 3 OS=Mus musculus GN=Slc7a3 PE=2 SV=1 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/62 (54%), Positives = 46/62 (74%)

Query: 43  LERASDAPQLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSL 102
           LE      +LAR L  +DL  LGVG+TLG GVYVLAG VA+++AGPS+VI F +AA++S+
Sbjct: 19  LELGMGETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSV 78

Query: 103 FS 104
            +
Sbjct: 79  LA 80




Mediates the uptake of the cationic amino acids arginine, lysine and ornithine in a sodium-independent manner.
Mus musculus (taxid: 10090)
>sp|O08812|CTR3_RAT Cationic amino acid transporter 3 OS=Rattus norvegicus GN=Slc7a3 PE=2 SV=1 Back     alignment and function description
>sp|Q8WY07|CTR3_HUMAN Cationic amino acid transporter 3 OS=Homo sapiens GN=SLC7A3 PE=1 SV=1 Back     alignment and function description
>sp|Q09143|CTR1_MOUSE High affinity cationic amino acid transporter 1 OS=Mus musculus GN=Slc7a1 PE=2 SV=1 Back     alignment and function description
>sp|Q5PR34|CTR2_DANRE Low affinity cationic amino acid transporter 2 OS=Danio rerio GN=slc7a2 PE=2 SV=1 Back     alignment and function description
>sp|P30825|CTR1_HUMAN High affinity cationic amino acid transporter 1 OS=Homo sapiens GN=SLC7A1 PE=1 SV=1 Back     alignment and function description
>sp|P30823|CTR1_RAT High affinity cationic amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a1 PE=2 SV=1 Back     alignment and function description
>sp|Q6DCE8|CTR2_XENLA Low affinity cationic amino acid transporter 2 OS=Xenopus laevis GN=slc7a2 PE=2 SV=1 Back     alignment and function description
>sp|B3TP03|CTR2_CHICK Low affinity cationic amino acid transporter 2 OS=Gallus gallus GN=SLC7A2 PE=2 SV=1 Back     alignment and function description
>sp|A8I499|CTR2_PIG Low affinity cationic amino acid transporter 2 OS=Sus scrofa GN=SLC7A2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
307197497 714 Low affinity cationic amino acid transpo 0.518 0.078 0.732 8e-15
332030638 713 Low affinity cationic amino acid transpo 0.694 0.105 0.441 2e-14
332017888 603 High affinity cationic amino acid transp 0.685 0.122 0.469 3e-14
307170851 612 Low affinity cationic amino acid transpo 0.685 0.120 0.436 4e-14
307169946 616 Cationic amino acid transporter 3 [Campo 0.5 0.087 0.759 7e-14
380019347 602 PREDICTED: LOW QUALITY PROTEIN: high aff 0.666 0.119 0.479 8e-14
195377771 579 GJ11800 [Drosophila virilis] gi|19415481 0.527 0.098 0.719 1e-13
345483731 620 PREDICTED: high affinity cationic amino 0.5 0.087 0.722 2e-13
345483725 599 PREDICTED: high affinity cationic amino 0.5 0.090 0.722 2e-13
322801571 603 hypothetical protein SINV_08605 [Solenop 0.694 0.124 0.505 2e-13
>gi|307197497|gb|EFN78731.1| Low affinity cationic amino acid transporter 2 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score = 84.3 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 49/56 (87%)

Query: 51  QLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVI 106
           QLAR L  +DLT LG+GATLGVGVYVLAGSV+++ AGP+VVISFAIAAV S+F+ I
Sbjct: 146 QLARYLSAVDLTALGIGATLGVGVYVLAGSVSKSTAGPAVVISFAIAAVASMFAGI 201




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332030638|gb|EGI70326.1| Low affinity cationic amino acid transporter 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|332017888|gb|EGI58548.1| High affinity cationic amino acid transporter 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307170851|gb|EFN62962.1| Low affinity cationic amino acid transporter 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307169946|gb|EFN62455.1| Cationic amino acid transporter 3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380019347|ref|XP_003693571.1| PREDICTED: LOW QUALITY PROTEIN: high affinity cationic amino acid transporter 1-like [Apis florea] Back     alignment and taxonomy information
>gi|195377771|ref|XP_002047661.1| GJ11800 [Drosophila virilis] gi|194154819|gb|EDW70003.1| GJ11800 [Drosophila virilis] Back     alignment and taxonomy information
>gi|345483731|ref|XP_003424873.1| PREDICTED: high affinity cationic amino acid transporter 1-like isoform 4 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345483725|ref|XP_003424871.1| PREDICTED: high affinity cationic amino acid transporter 1-like isoform 2 [Nasonia vitripennis] gi|345483727|ref|XP_001599622.2| PREDICTED: high affinity cationic amino acid transporter 1-like isoform 1 [Nasonia vitripennis] gi|345483729|ref|XP_003424872.1| PREDICTED: high affinity cationic amino acid transporter 1-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322801571|gb|EFZ22227.1| hypothetical protein SINV_08605 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
FB|FBgn0036764 633 CG5535 [Drosophila melanogaste 0.592 0.101 0.584 4.8e-14
FB|FBgn0036493 1063 CG7255 [Drosophila melanogaste 0.5 0.050 0.722 1.7e-13
FB|FBgn0037203 604 slif "slimfast" [Drosophila me 0.518 0.092 0.714 1.9e-13
UNIPROTKB|Q5JR49121 SLC7A1 "High affinity cationic 0.5 0.446 0.611 3.1e-12
RGD|1305905 463 Slc7a4 "solute carrier family 0.601 0.140 0.507 3.9e-12
WB|WBGene00015197 585 B0454.6 [Caenorhabditis elegan 0.490 0.090 0.547 5.3e-12
ZFIN|ZDB-GENE-080219-39 613 zgc:175280 "zgc:175280" [Danio 0.583 0.102 0.539 6.4e-12
UNIPROTKB|F1RK99 635 SLC7A4 "Uncharacterized protei 0.601 0.102 0.523 6.8e-12
UNIPROTKB|F1MUG8 619 SLC7A3 "Uncharacterized protei 0.620 0.108 0.522 1.1e-11
UNIPROTKB|Q8WY07 619 SLC7A3 "Cationic amino acid tr 0.620 0.108 0.522 1.1e-11
FB|FBgn0036764 CG5535 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 191 (72.3 bits), Expect = 4.8e-14, P = 4.8e-14
 Identities = 38/65 (58%), Positives = 53/65 (81%)

Query:    40 KLPLERASDAPQLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAV 99
             K PLE ++++ +LA+VL   DLT LG+G+TLGVGVYVLAG V++  AGP+VV+SF IAA+
Sbjct:    28 KKPLEDSNES-KLAKVLSAFDLTALGIGSTLGVGVYVLAGEVSKQYAGPAVVVSFLIAAI 86

Query:   100 TSLFS 104
              S+F+
Sbjct:    87 ASIFA 91




GO:0006865 "amino acid transport" evidence=ISS
GO:0015326 "cationic amino acid transmembrane transporter activity" evidence=ISS
GO:0016020 "membrane" evidence=IEA
GO:0003333 "amino acid transmembrane transport" evidence=ISS
GO:0015171 "amino acid transmembrane transporter activity" evidence=ISS
FB|FBgn0036493 CG7255 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0037203 slif "slimfast" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5JR49 SLC7A1 "High affinity cationic amino acid transporter 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305905 Slc7a4 "solute carrier family 7 (orphan transporter), member 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00015197 B0454.6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080219-39 zgc:175280 "zgc:175280" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RK99 SLC7A4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MUG8 SLC7A3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WY07 SLC7A3 "Cationic amino acid transporter 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B3TP03CTR2_CHICKNo assigned EC number0.60780.47220.0779yesN/A
P70423CTR3_MOUSENo assigned EC number0.54830.57400.1003yesN/A
O08812CTR3_RATNo assigned EC number0.54830.57400.1001yesN/A
Q8WY07CTR3_HUMANNo assigned EC number0.52170.63880.1114yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
TIGR00906 557 TIGR00906, 2A0303, cationic amino acid transport p 1e-16
TIGR00909 429 TIGR00909, 2A0306, amino acid transporter 3e-10
COG1113 462 COG1113, AnsP, Gamma-aminobutyrate permease and re 0.003
>gnl|CDD|129984 TIGR00906, 2A0303, cationic amino acid transport permease Back     alignment and domain information
 Score = 73.3 bits (180), Expect = 1e-16
 Identities = 25/56 (44%), Positives = 39/56 (69%)

Query: 51  QLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVI 106
           ++ R L   DL  LG+G+T+G G+YVL G VARN +GP++V+SF I+ + ++ S  
Sbjct: 25  KMKRCLTTWDLMALGIGSTIGAGIYVLTGEVARNDSGPAIVLSFLISGLAAVLSGF 80


[Transport and binding proteins, Amino acids, peptides and amines]. Length = 557

>gnl|CDD|129987 TIGR00909, 2A0306, amino acid transporter Back     alignment and domain information
>gnl|CDD|224038 COG1113, AnsP, Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 108
TIGR00906 557 2A0303 cationic amino acid transport permease. 99.5
PRK15049 499 L-asparagine permease; Provisional 99.3
PRK10249 458 phenylalanine transporter; Provisional 99.24
KOG1286|consensus 554 99.17
PRK10836 489 lysine transporter; Provisional 99.17
PRK11387 471 S-methylmethionine transporter; Provisional 99.16
PRK11049 469 D-alanine/D-serine/glycine permease; Provisional 99.11
PRK10238 456 aromatic amino acid transporter; Provisional 99.1
PRK10746 461 putative transport protein YifK; Provisional 99.1
COG0833 541 LysP Amino acid transporters [Amino acid transport 99.08
PRK10580 457 proY putative proline-specific permease; Provision 99.04
TIGR01773 452 GABAperm gamma-aminobutyrate permease. GabP is hig 98.98
COG1113 462 AnsP Gamma-aminobutyrate permease and related perm 98.96
TIGR00913 478 2A0310 amino acid permease (yeast). 98.84
PRK10435 435 cadB lysine/cadaverine antiporter; Provisional 98.79
PRK11357 445 frlA putative fructoselysine transporter; Provisio 98.79
TIGR00911 501 2A0308 L-type amino acid transporter. 98.76
PRK10655 438 potE putrescine transporter; Provisional 98.75
PRK10644 445 arginine:agmatin antiporter; Provisional 98.74
PRK11021 410 putative transporter; Provisional 98.72
TIGR03810 468 arg_ornith_anti arginine/ornithine antiporter. Mem 98.66
TIGR00905 473 2A0302 transporter, basic amino acid/polyamine ant 98.65
KOG1287|consensus 479 98.58
TIGR00909 429 2A0306 amino acid transporter. 98.47
PRK10197 446 gamma-aminobutyrate transporter; Provisional 98.41
TIGR03428 475 ureacarb_perm permease, urea carboxylase system. A 98.33
TIGR00908 442 2A0305 ethanolamine permease. The three genes used 98.25
TIGR00907 482 2A0304 amino acid permease (GABA permease). 98.08
TIGR00930 953 2a30 K-Cl cotransporter. 97.98
TIGR00912 359 2A0309 spore germination protein (amino acid perme 97.67
COG0531 466 PotE Amino acid transporters [Amino acid transport 97.43
PF00324 478 AA_permease: Amino acid permease; InterPro: IPR004 97.29
PF13520 426 AA_permease_2: Amino acid permease; PDB: 3NCY_A 3G 97.21
PRK15238 496 inner membrane transporter YjeM; Provisional 96.78
TIGR00837 381 araaP aromatic amino acid transport protein. aroma 96.64
PHA02764 399 hypothetical protein; Provisional 95.76
KOG1289|consensus 550 95.73
PF01235 416 Na_Ala_symp: Sodium:alanine symporter family; Inte 93.49
PF03222 394 Trp_Tyr_perm: Tryptophan/tyrosine permease family; 91.89
PRK10483 414 tryptophan permease; Provisional 91.35
COG0814 415 SdaC Amino acid permeases [Amino acid transport an 90.9
COG1115 452 AlsT Na+/alanine symporter [Amino acid transport a 90.64
TIGR03813 474 put_Glu_GABA_T putative glutamate/gamma-aminobutyr 89.85
PRK09664 415 tryptophan permease TnaB; Provisional 89.71
PF03845 320 Spore_permease: Spore germination protein; InterPr 89.17
TIGR00814 397 stp serine transporter. The HAAAP family includes 85.09
TIGR00835 425 agcS amino acid carrier protein. Members of the AG 82.74
PRK15132 403 tyrosine transporter TyrP; Provisional 81.13
TIGR00910 507 2A0307_GadC glutamate:gamma-aminobutyrate antiport 80.43
>TIGR00906 2A0303 cationic amino acid transport permease Back     alignment and domain information
Probab=99.50  E-value=3.3e-14  Score=119.74  Aligned_cols=81  Identities=37%  Similarity=0.649  Sum_probs=70.4

Q ss_pred             hHHHHHHHhhccccCCCCCchhhhccCCCCCCCCCCCCCccccCCCccccccccChhhHHHHhhcceecchhhhccHHhH
Q psy6063           3 RLRNLYEALSRKKIDVGDDDVSIAEGKNPAGGADGVGKLPLERASDAPQLARVLGLIDLTMLGVGATLGVGVYVLAGSVA   82 (108)
Q Consensus         3 ~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~R~L~~~~l~~l~vG~iIGtGiFv~~G~~~   82 (108)
                      ....|.++|+|||+++.+                         +.++++++|+|+.++++++++|++||+|+|+.+|.++
T Consensus         2 ~~~~~~~~~~r~k~~~~~-------------------------~~~~~~L~r~L~~~~l~~l~ig~viGsGIf~l~g~~a   56 (557)
T TIGR00906         2 AVLTFARCLIRRKIVDLD-------------------------SREESKMKRCLTTWDLMALGIGSTIGAGIYVLTGEVA   56 (557)
T ss_pred             chHHHHHHHhccCCcccc-------------------------cccccchhhcCCHHHHHHHHhhhhhcchhhhhhhHHH
Confidence            456788999999999651                         1224469999999999999999999999999999876


Q ss_pred             HhhcChHHHHHHHHHHHHHHHHhhcC
Q psy6063          83 RNQAGPSVVISFAIAAVTSLFSVIIL  108 (108)
Q Consensus        83 ~~~aGp~~llawil~giv~l~~al~y  108 (108)
                      ...+||+++++|+++|+.+++.++||
T Consensus        57 ~~~aGp~~~ls~liagv~~l~~al~y   82 (557)
T TIGR00906        57 RNDSGPAIVLSFLISGLAAVLSGFCY   82 (557)
T ss_pred             HhccCcHHHHHHHHHHHHHHHHHHHH
Confidence            45699999999999999999999997



>PRK15049 L-asparagine permease; Provisional Back     alignment and domain information
>PRK10249 phenylalanine transporter; Provisional Back     alignment and domain information
>KOG1286|consensus Back     alignment and domain information
>PRK10836 lysine transporter; Provisional Back     alignment and domain information
>PRK11387 S-methylmethionine transporter; Provisional Back     alignment and domain information
>PRK11049 D-alanine/D-serine/glycine permease; Provisional Back     alignment and domain information
>PRK10238 aromatic amino acid transporter; Provisional Back     alignment and domain information
>PRK10746 putative transport protein YifK; Provisional Back     alignment and domain information
>COG0833 LysP Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10580 proY putative proline-specific permease; Provisional Back     alignment and domain information
>TIGR01773 GABAperm gamma-aminobutyrate permease Back     alignment and domain information
>COG1113 AnsP Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00913 2A0310 amino acid permease (yeast) Back     alignment and domain information
>PRK10435 cadB lysine/cadaverine antiporter; Provisional Back     alignment and domain information
>PRK11357 frlA putative fructoselysine transporter; Provisional Back     alignment and domain information
>TIGR00911 2A0308 L-type amino acid transporter Back     alignment and domain information
>PRK10655 potE putrescine transporter; Provisional Back     alignment and domain information
>PRK10644 arginine:agmatin antiporter; Provisional Back     alignment and domain information
>PRK11021 putative transporter; Provisional Back     alignment and domain information
>TIGR03810 arg_ornith_anti arginine/ornithine antiporter Back     alignment and domain information
>TIGR00905 2A0302 transporter, basic amino acid/polyamine antiporter (APA) family Back     alignment and domain information
>KOG1287|consensus Back     alignment and domain information
>TIGR00909 2A0306 amino acid transporter Back     alignment and domain information
>PRK10197 gamma-aminobutyrate transporter; Provisional Back     alignment and domain information
>TIGR03428 ureacarb_perm permease, urea carboxylase system Back     alignment and domain information
>TIGR00908 2A0305 ethanolamine permease Back     alignment and domain information
>TIGR00907 2A0304 amino acid permease (GABA permease) Back     alignment and domain information
>TIGR00930 2a30 K-Cl cotransporter Back     alignment and domain information
>TIGR00912 2A0309 spore germination protein (amino acid permease) Back     alignment and domain information
>COG0531 PotE Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>PF00324 AA_permease: Amino acid permease; InterPro: IPR004841 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>PF13520 AA_permease_2: Amino acid permease; PDB: 3NCY_A 3GI8_C 3GIA_A 3GI9_C 3OB6_A 3L1L_A 3LRC_D 3LRB_B 4DJK_A 4DJI_A Back     alignment and domain information
>PRK15238 inner membrane transporter YjeM; Provisional Back     alignment and domain information
>TIGR00837 araaP aromatic amino acid transport protein Back     alignment and domain information
>PHA02764 hypothetical protein; Provisional Back     alignment and domain information
>KOG1289|consensus Back     alignment and domain information
>PF01235 Na_Ala_symp: Sodium:alanine symporter family; InterPro: IPR001463 Sodium symporters can be divided by sequence and functional similarity into various groups Back     alignment and domain information
>PF03222 Trp_Tyr_perm: Tryptophan/tyrosine permease family; InterPro: IPR018227 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>PRK10483 tryptophan permease; Provisional Back     alignment and domain information
>COG0814 SdaC Amino acid permeases [Amino acid transport and metabolism] Back     alignment and domain information
>COG1115 AlsT Na+/alanine symporter [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03813 put_Glu_GABA_T putative glutamate/gamma-aminobutyrate antiporter Back     alignment and domain information
>PRK09664 tryptophan permease TnaB; Provisional Back     alignment and domain information
>PF03845 Spore_permease: Spore germination protein; InterPro: IPR004761 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>TIGR00814 stp serine transporter Back     alignment and domain information
>TIGR00835 agcS amino acid carrier protein Back     alignment and domain information
>PRK15132 tyrosine transporter TyrP; Provisional Back     alignment and domain information
>TIGR00910 2A0307_GadC glutamate:gamma-aminobutyrate antiporter Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
3gia_A 444 Uncharacterized protein MJ0609; membrane protein, 9e-14
3l1l_A 445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC 5e-09
4djk_A 511 Probable glutamate/gamma-aminobutyrate antiporter; 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Length = 444 Back     alignment and structure
 Score = 64.6 bits (158), Expect = 9e-14
 Identities = 11/54 (20%), Positives = 25/54 (46%), Gaps = 1/54 (1%)

Query: 51  QLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFS 104
              + L L +   + VG  +G  ++ + G  A   AG ++  +F ++ + +L  
Sbjct: 3   LKNKKLSLWEAVSMAVGVMIGASIFSIFGVGA-KIAGRNLPETFILSGIYALLV 55


>3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3ob6_A* 3hqk_A 3ncy_A Length = 445 Back     alignment and structure
>4djk_A Probable glutamate/gamma-aminobutyrate antiporter; LEUT, glutamate-GABA antiporter, transport protein; 3.10A {Escherichia coli} PDB: 4dji_A Length = 511 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
3l1l_A 445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC 98.72
3gia_A 444 Uncharacterized protein MJ0609; membrane protein, 98.62
4djk_A 511 Probable glutamate/gamma-aminobutyrate antiporter; 97.26
>3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3ob6_A* 3hqk_A 3ncy_A Back     alignment and structure
Probab=98.72  E-value=7.4e-09  Score=80.89  Aligned_cols=57  Identities=25%  Similarity=0.457  Sum_probs=49.6

Q ss_pred             cccccccChhhHHHHhhcceecchhhhccHHhHHhhcChHHHHHHHHHHHHHHHHhhcC
Q psy6063          50 PQLARVLGLIDLTMLGVGATLGVGVYVLAGSVARNQAGPSVVISFAIAAVTSLFSVIIL  108 (108)
Q Consensus        50 ~~l~R~L~~~~l~~l~vG~iIGtGiFv~~G~~~~~~aGp~~llawil~giv~l~~al~y  108 (108)
                      .+.+|+++.++++++++|.+||+|+|..++..+  .+||..+++|+++++++++.++||
T Consensus         4 ~~~~r~l~~~~~~~l~ig~~iG~Gif~~~~~~~--~~G~~~~~~~li~~~~~~~~a~~~   60 (445)
T 3l1l_A            4 DADAHKVGLIPVTLMVSGAIMGSGVFLLPANLA--STGGIAIYGWLVTIIGALGLSMVY   60 (445)
T ss_dssp             ---CCCBCHHHHHHHHHHHHCSSHHHHHHHHHH--HHCTHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCcccHHHHHHHHHHhHHhhhHHhhHHHHH--HhhhHHHHHHHHHHHHHHHHHHHH
Confidence            457899999999999999999999999998754  589988899999999999999876



>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Back     alignment and structure
>4djk_A Probable glutamate/gamma-aminobutyrate antiporter; LEUT, glutamate-GABA antiporter, transport protein; 3.10A {Escherichia coli} PDB: 4dji_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00