Diaphorina citri psyllid: psy6065


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MAIQLPPCPDSLKAIQHFLNVASEHDNRDLTVSYWCRLHALQKALKIDKSSDGAKMLLLKLMDWLEQEKKTHRDNDTIMNETAAQAYIENYALKLFQWADSMDRASTFNKNVVKAFYTASILMDVLQTFGETSEDIEQNKKYAKWKAAYIHNCLKSGETPIPGPPESGEGSEGPSLSSQNSNDQLPSPPRENSNEDVTPSFPAPTSSGGTLPSPPSMPQNLPGPSISGPLIPGPSIPSFPSPAVTPSSPSTPAPQPAMPALVTQPEQEISYIEAELINKCQKYIKFASSALNYDDYKEAKSNLIKVLNILNTGRES
cccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccc
******P**DSLKAIQHFLNVASEHDNRDLTVSYWCRLHALQKALKIDKSSDGAKMLLLKLMDWLEQE*******DTIMNETAAQAYIENYALKLFQWADSMDRASTFNKNVVKAFYTASILMDVLQTFGETSEDIEQNKKYAKWKAAYIHNCLK*******************************************************************************************************************YIEAELINKCQKYIKFASSALNYDDYKEAKSNLIKVLNILNT****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIQLPPCPDSLKAIQHFLNVASEHDNRDLTVSYWCRLHALQKALKIDKSSDGAKMLLLKLMDWLEQEKKTHRDNDTIMNETAAQAYIENYALKLFQWADSMDRASTFNKNVVKAFYTASILMDVLQTFGETSEDIEQNKKYAKWKAAYIHNCLKSGETPIPGPPESGEGSEGPSLSSQNSNDQLPSPPRENSNEDVTPSFPAPTSSGGTLPSPPSMPQNLPGPSISGPLIPGPSIPSFPSPAVTPSSPSTPAPQPAMPALVTQPEQEISYIEAELINKCQKYIKFASSALNYDDYKEAKSNLIKVLNILNTGRES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein VTA1 homolog Involved in the endosomal multivesicular bodies (MVB) pathway. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. Thought to be a cofactor of VPS4A/B, which catalyzes disassembles membrane-associated ESCRT-III assemblies. Involved in the sorting and down-regulation of EGFR (By similarity). Involved in HIV-1 budding.confidentQ9NP79
Vacuolar protein sorting-associated protein VTA1 homolog Involved in the endosomal multivesicular bodies (MVB) pathway. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. Thought to be a cofactor of VPS4A/B, which catalyzes disassembles membrane-associated ESCRT-III assemblies. Involved in the sorting and down-regulation of EGFR.confidentQ5R5W5
Vacuolar protein sorting-associated protein VTA1 homolog Involved in the endosomal multivesicular bodies (MVB) pathway. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. Thought to be a cofactor of VPS4A/B, which catalyzes disassembles membrane-associated ESCRT-III assemblies. Involved in the sorting and down-regulation of EGFR.confidentQ32L63

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LXL, chain A
Confidence level:very confident
Coverage over the Query: 11-161
View the alignment between query and template
View the model in PyMOL
Template: 2RKL, chain A
Confidence level:confident
Coverage over the Query: 271-312
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 201-214
View the alignment between query and template
View the model in PyMOL