Diaphorina citri psyllid: psy6066

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370

MAPPKKLGKKKVVGKSKKVAPAPLAVKKVEVKKVVNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSSDKANLAKLIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLERAKAKELAQKV

cccccccccccccccccccccccccHHHHHHccccccHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEcccEEEEEEcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEcccEEEEEEcccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcc

**********************************VNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEKYR********************************IKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESWEAKKQRLKARAEKKIAKKEDTPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSSDKANLAKLIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLERAKAKE*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAPPKKLGKKKVVGKSKKVAPAPLAVKKVEVKKVVNPLFEKKARNFGIGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTGQDIQPKRDLSRFVKWPKYIRIQRQKAVLQKRLKVPPPVHQFTQAVDKQTASQLFKFLEKYRPESWxxxxxxxxxxxxxxxxxxxxxPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELFKFLEKYRPESWxxxxxxxxxxxxxxxxxxxxxPTKKPNQIKQGTNTVTRLVVKKKASLVIIAHDVDPIELVLFLPALCRKMGIPYCIVDSSDKANLAKLIESVKVNFTDRYDEIRRQWGGGSLGSKSAARIAKLERAKAKELAQKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
60S ribosomal protein L8-B		confident	P29453
50S ribosomal protein L7Ae	Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, box H/ACA, box C/D and box C'/D' sRNAs.	confident	Q8U160
60S ribosomal protein L7a		confident	P46223

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0022625 [CC]	cytosolic large ribosomal subunit	probable	GO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0048856 [BP]	anatomical structure development	probable	GO:0032502, GO:0008150
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0005774 [CC]	vacuolar membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044767 [BP]	single-organism developmental process	probable	GO:0032502, GO:0008150, GO:0044699
GO:0007275 [BP]	multicellular organismal development	probable	GO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009987 [BP]	cellular process	probable	GO:0008150
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0022414 [BP]	reproductive process	probable	GO:0008150, GO:0000003
GO:0042788 [CC]	polysomal ribosome	probable	GO:0005737, GO:0005844, GO:0032991, GO:0005840, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0009506 [CC]	plasmodesma	probable	GO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0009507 [CC]	chloroplast	probable	GO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain f
Confidence level:very confident
Coverage over the Query: 161-167,239-328
View the alignment between query and template
View the model in PyMOL

Template: 2ZKR, chain f
Confidence level:very confident
Coverage over the Query: 171-230,246-306
View the alignment between query and template
View the model in PyMOL

Template: 3ZF7, chain x
Confidence level:confident
Coverage over the Query: 95-237,269-351
View the alignment between query and template
View the model in PyMOL